KEGG   Macaca mulatta (rhesus monkey): 712848Help
Entry
712848            CDS       T01028                                 

Gene name
RPTOR
Definition
regulatory associated protein of MTOR, complex 1
Orthology
K07204  
regulatory associated protein of mTOR
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    712848 (RPTOR)
   04152 AMPK signaling pathway
    712848 (RPTOR)
   04150 mTOR signaling pathway
    712848 (RPTOR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    712848 (RPTOR)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    712848 (RPTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 1335 aa AA seqDB search
MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIY
DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNC
IQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPG
RLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSY
NCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL
TMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLL
QSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILA
VIVNSYNTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSA
HEKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLVSDGSPMVR
KELVVALSHLVVQYESNFCTVALQFIEEEKNYPLPSPATTEGGSLTPVRDSPCTPRLRSV
SSYGNIRAVATARSLNKSLQNLSLTEESGGAVAFSPGNLSTSSSASSTLGSPENEEHILS
FETIDKMRRASSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPEVSDVAMKVLNSIAYK
APGNAHPQCEIQASSVSQAQPASPTNKGVHIHQAGGSPPASSTSSSSLTNDVAKQPVSRD
LPSGRPGTTGPAGAQYTPHSHQFPRTRKMFDKGPEQTADDADDAAGHKSFISATVQTGFC
DWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNSRVRRQAQQVIQKGITRLDDQIFLN
RNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQD
CSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMS
SGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALS
ECRVMTYREHTAWVVKASLQKRPDGHIVSVSVNGDVRIFDPRMPESVNVLQIVKGLTALD
IHPQADLIACGSVNQFTAIYNGGGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGS
NDYYISVYSVEKRVR
NT seq 4008 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgaaatgctgcagtcgcctcttctgggcctgggggaggaagatgaggctgat
cttacagactggaacctacctttggcttttatgaaaaagaggcactgtgagaaaattgaa
ggctccaaatccttagctcaaagctggaggatgaaggatcggatgaagacagtcagtgtt
gccttagttttgtgcctgaatgttggtgtggaccctcccgatgtggtgaagaccacgccc
tgtgcgcgcttggaatgctggatcgatcctctgtcgatgggtcctcagaaagctctggaa
accatcggtgcaaatttacagaagcagtacgagaactggcagccaagggcccggtacaag
cagagccttgacccaactgtggatgaagtcaagaagctctgcacgtccctacgtcgcaac
gccaaggaggagcgagtcctctttcactacaatggccacggggtgccccggcccacagtg
aacggggaggtctgggtcttcaacaagaactacacgcagtacatccctctgtccatatat
gacctgcagacatggatgggcagcccgtcgatcttcgtctatgactgctccaacgctggc
ttgatcgtcaagtccttcaagcagttcgcactacagcgggagcaggagctggaggtagct
gcaatcaacccaaatcaccctcttgctcagatgcctttgcctccgtcgatgaaaaactgc
atccagctggcagcctgcgaggccactgagctgctgcccatgatccccgacctcccggct
gacctgttcacctcctgcctcaccacccccatcaagatcgccctgcgctggttttgcatg
cagaaatgtgtcagtctggtgcctggcgtcacactggatttgatagaaaagatccctggc
cgcctgaacgacaggaggacgcccctgggtgagctgaactggatcttcacagccatcaca
gacaccatcgcatggaacgtgctccctcgggatctcttccaaaagctcttcagacaggac
ttactggtggctagtctgttccgaaattttttattggcggaaaggattatgaggtcgtac
aactgcactcccgtcagcagcccgcgtctgccgcccacgtacatgcatgcgatgtggcaa
gcctgggacctggctgtcgacatctgtctgtcccagctgccgacgatcattgaggaaggc
actgcgtttcggcacagcccgttcttcgccgagcagctgaccgctttccaggtgtggctc
accatgggcgtggagaaccggaacccaccggaacagctgcccatcgtcctgcaggtgctg
ttaagccaagtgcaccggctgagagcattggacttgcttggaagatttttggacctgggt
ccctgggcagtgagcctggccttgtccgtcggcatcttcccctacgtgctgaagctgctc
cagagctcggcccgagagctgcggccacttctcgttttcatctgggccaagatcctcgca
gtggacagctcgtgccaggcggacctcgtgaaggacaacggccacaagtacttcctgtcg
gtcctggcggacccctacatgccagccgaacacaggaccatgacggctttcattctcgcc
gtgattgtcaacagctataacacggggcaggaagcctgccttcagggaaacctcattgcc
atctgcctggagcagctcaacgacccgcaccccttgctgcgccagtgggtggccatctgc
ctcggcaggatctggcagaacttcgactcggcgaggtggtgcggcgtgagggacagcgct
cacgagaagctctacagcctcctgtccgaccccattcccgaggtccgctgcgcggcggtc
tttgcccttggcacgttcgtgggcaactctgcagagaggacggaccactccaccaccatt
gaccacaacgtggccatgatgctggcccagctggtcagcgacgggagccccatggtccgg
aaggagctggtggtggctctgagtcatctcgtggttcagtacgaaagcaatttctgcact
gtggccctgcagttcatagaagaggagaagaactaccccttgccttctccagcgaccaca
gagggagggagtctgaccccagtgcgagacagcccgtgcacccccagacttcgttccgtg
agctcctatggaaacatccgtgctgtcgccacagccaggagcctcaacaaatctttgcag
aacctgagcttgacagaggaatccggcggcgcggtggcgttctcccctggaaacctcagc
accagcagcagtgccagcagtaccctgggcagccccgaaaatgaggagcacatcctgtcc
ttcgagaccatcgacaagatgcgccgcgccagctcctactcctccctcaactccctcatc
ggagtttcctttaatagcgtttacactcagatttggagagtcctgctgcacctggctgct
gacccctatccagaggtctcagacgtggccatgaaagtgctcaacagcatcgcctataag
gcacctggcaacgctcatccccagtgtgagattcaggccagcagtgtgagccaagcgcag
cctgccagccccaccaacaagggtgtgcacatccaccaggcggggggctcccctccagcg
tccagcaccagcagctccagcctgaccaatgacgtggccaagcagccggtcagccgagac
ctgccttctggccggccgggcaccacaggccccgcgggggcgcaatacacccctcactcc
caccagttcccccggacacggaagatgttcgacaagggcccagagcagactgcggacgat
gcagacgatgctgctggacacaaaagcttcatctccgccacggtgcagacggggttctgc
gactggagtgcccgctatttcgcccagcccgtcatgaagatcccggaagagcacgacctg
gagagtcagatccgcaaggagcgggagtggcggttcctgcgaaacagccgcgtcaggagg
caggcccagcaagtcatccagaagggcattacgagattggacgaccaaatatttctgaac
aggaaccccggcgtcccctctgtggtgaaattccaccccttcacgccgtgcatcgccgtc
gccgacaaggacagcatctgcttttgggactgggagaaaggggagaaactggactatttc
cacaatgggaaccctcggtacacaagggtcactgccatggagtatctgaacggccaggac
tgctcactcctgctgacggccacagacgatggtgccatcagggtctggaagaattttgct
gatttggaaaagaacccagagatggtgaccgcgtggcaggggctctcggacatgctgcca
acaacgcgaggagccgggatggtggtggactgggagcaggagaccggcctcctcatgagc
tcgggggacgtgcggatcgtccggatctgggacacagaccgtgagatgaaggtgcaggac
atccccacgggcgcagacagctgcgtgacgagcctgtcctgtgattcccaccgctcactc
atcgtggctggcctcggtgatggctccatccgcgtctacgacagaaggatggcactcagc
gaatgccgcgtcatgacgtaccgcgagcacacggcctgggtggtgaaggcctctctgcag
aagcgccccgacggccacatcgtgagcgtgagtgtcaatggagacgtgcgcatctttgat
ccccggatgcccgagtcggtgaatgtgcttcagatcgtgaaggggctgacagccctggac
atccacccccaggcggacctgatcgcatgtggctccgtcaatcagttcactgccatctac
aatgggggcggcgagctgatcaacaacatcaagtactacgacggcttcatgggtcagcgg
gtcggcgccatcagctgcctggccttccacccacactggcctcacctggccgtgggaagc
aacgactactacatctccgtgtactcggtggagaagcgcgtcagatag

DBGET integrated database retrieval system