KEGG   Macaca mulatta (rhesus monkey): 712898Help
Entry
712898            CDS       T01028                                 

Gene name
TACC3
Definition
(RefSeq) transforming, acidic coiled-coil containing protein 3
  KO
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    712898 (TACC3)
Messenger RNA biogenesis [BR:mcc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     712898 (TACC3)
   mRNA cycle factors
    P-body specific factors
     712898 (TACC3)
Chromosome [BR:mcc03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   TACC proteins
    712898 (TACC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 836 aa AA seqDB search
MSLQVLNDKNVSSEKSTENCDFLFSSPEVTGRSSVLRVSQKENVPPKNVAKAMKVTFQTP
LRDPQTHRILSPSMASKLEAPLAQGDTLGLENCHPVWTQKENQQLIKEVDAKTTHGILQK
PVEADANLLGDASPAFGSGSASEPGPGALADLDCSSSSQSPGSSENQMVSPEKVSGSPEQ
ALEENISSYSLDRKMTPTFETLEDPSRTESQHKAETPHRAKEECRHGGVSAPTAGATSPP
SAIPEEACGGAPLGGLPGEALACPVGMGTPVPADDTQALPCAHTSCPESTAPTSHLVTGR
AMTLSPQEEAAVDQMASSSRSGPIKLEFDLSDGATSKRAAPPRRLGERSGLKPPLRRAAA
RQQKALREVEEDPPMPASRGSYHLDWDKLDDPNFNPFRGDTLSGHREAQPPESPETRLGR
PASEQLSAGPATEEPGTCLSQQLHSASAEDTPVVQLTAETPRAESKEGALNSASISLPTS
CPGSEPVPTHQQGQPAFELKEESFRDPAEVLGMGAEVDYLEQFGTSSFKESALRKQSLYL
KFDPLLRDSPRRPVPVAVETSSMHGANEPPSGSPREAKLVEFDFLGALDIPVTGKRQGRN
GFLVHPHLLQVPGPPPGVPAPGGPPLSTGPIVDLLQYSQKDLDAAVKATQEENRELRSRC
EELHGKNLELGKIMDRFEEVVYQAMEEVQKQKELAKAEIQKVLKEKDQLTTDLNSMEKSF
SDLFKRFEKQKEVIEGYRKNEESLKKCVEDYLAKITQEGQRYQALKAHAEEKLQLANEEI
AQVRSKAQAEVLALQASLRKEQMRIQSLEKTVEQKTKENEELTRICDDLISKMEKI
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgcaggtcttaaacgacaaaaatgtcagcagtgaaaaaagtacagaaaattgc
gacttcctgttttcctcaccagaagttaccggaagatcgtctgttcttcgtgtgtcacag
aaagaaaatgtgccacccaagaacgtggccaaagctatgaaggtgacttttcagacacct
ctgcgggatccacagacgcacaggattctaagtcctagcatggccagcaaacttgaggct
cctttggctcagggtgatacccttggactggaaaactgtcacccggtgtggacgcagaaa
gagaaccaacagctcatcaaggaagtggatgccaaaactactcatggaattctacagaaa
ccagtggaggctgacgccaacctcctgggggatgcaagcccagcctttgggagtggcagc
gccagcgagcctggcccgggtgccctggctgacctggactgctcaagttcttcccagagc
ccaggaagttctgagaaccaaatggtgtctccagaaaaagtgtctggcagccctgaacaa
gccttggaggaaaatattagttcctattccttagacagaaaaatgacacccacctttgag
accctagaagacccttccaggacagagtcccagcacaaagcagagactccacacagagcc
aaggaagaatgccggcatggtggggtctctgctcccacagcaggggccacttcgcctcct
agtgcgatccctgaggaagcctgtggaggagcacccctggggggtctgcctggtgaggcc
ctggcctgccctgtgggtatgggcacccccgtgccagcagatgacactcaggcccttccc
tgtgcacacacttcttgtcctgagagcacagccccgaccagccacctggtgactggcagg
gccatgaccctgagtcctcaggaagaagcagctgtggaccaaatggccagctcctcgagg
agcggacccataaaactagaatttgatttatctgatggcgccaccagcaaaagggcagcc
ccaccaaggagactgggagagagatctggcctcaagcctcccttgaggagagcagcagcg
aggcagcaaaaggccctgcgggaggtggaggaggacccccccatgccggcttctcggggc
tcttaccacctcgactgggacaaactggatgacccaaacttcaacccattcagaggtgac
accctgtctggtcacagagaggcccagcccccagaaagccctgagaccaggctgggccgg
ccagcgtctgaacagctgagtgctgggcctgccacggaggagccaggcacgtgtctgagc
cagcagctgcattcagcctcagcggaggacacacctgtggtgcagctgacagctgagacc
ccaagagcagagagcaaggagggagccttgaactctgccagcatctcgcttcccacaagc
tgtccgggcagtgagccagtgcccacccatcagcaggggcagcctgccttcgagctgaaa
gaggagagcttcagagaccccgctgaggttctaggcatgggcgcagaggtggattacctg
gagcagtttggaacttcctcgtttaaggagtcggccttgaggaagcagtccttgtacctc
aagttcgaccccctgctgagggacagtcctcgtagaccagtgcccgtggccgtggagacc
agcagcatgcacggtgcaaatgagcctccctcaggaagtccgcgggaagccaagcttgtg
gagttcgatttcttaggagcactggacattcctgtcacaggcaagaggcaagggcgaaat
gggttcctggttcatccccatctcctgcaggtgccaggcccacctccaggtgtccccgca
cctgggggcccacccctgtccaccgggcctatagtggacctgctccagtacagccagaag
gacctggatgcagcggtaaaggctacacaggaggagaaccgggagctgaggagcaggtgt
gaggagctccacgggaagaacctagagctggggaaaatcatggacaggttcgaagaggtc
gtgtaccaggccatggaggaagttcagaaacagaaggaacttgccaaagctgaaatccag
aaagttctaaaagaaaaagaccaacttactacagacctgaattccatggagaagtccttc
tccgacctcttcaagcgttttgagaaacagaaggaggtgatcgagggctaccgcaagaac
gaagagtcactgaagaagtgtgtggaggattacctggcgaagatcacccaggaaggccag
aggtaccaagccctgaaggcgcatgcggaggagaagctgcagctggcaaacgaggagatc
gcccaagtccggagcaaggcccaggcggaagtgttggccctccaggccagcttgaggaag
gagcagatgcggatccagtcgctggagaagacagtggagcagaagactaaagagaatgag
gagctgaccaggatctgcgacgacctcatctccaagatggagaagatctga

DBGET integrated database retrieval system