KEGG   Macaca mulatta (rhesus monkey): 712898Help
Entry
712898            CDS       T01028                                 

Gene name
TACC3
Definition
transforming, acidic coiled-coil containing protein 3
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    712898 (TACC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 827 aa AA seqDB search
MSLQVLNDKNVSSEKSTENCDFLFSSPEVTGRSSVLRVSQKENVPPKNVAKAMKVTFQTP
LRDPQTHRILSPSMASKLEAPLAQGDTLGLENCHPVWTQKENQQLIKEVDAKTTHGILQK
PVEADANLLGDASPAFGSGSASEPGPGALADLDCSSSSQSPGSSENQMVSPEKVSGSPEQ
ALEENISSYSLDRKMTPTFETLEDPSRTESQHKAETPHRAKEECRHGGVSAPTAGATSPP
SAIPEEACGGAPLGGLPGEALACPVGMGTPVPADDTQALPCAHTSCPESTAPTSHLVTGR
AMTLSPQEEAAVDQMASSSRSGPIKLEFDLSDGATSKRAAPPRRLGERSGLKPPLRRAAA
RQQKALREVEEDPPMPASRGSYHLDWDKLDDPNFNPFRGDTLSGHREAQPPESPETRLGR
PASEQLSAGPATEEPGTCLSQQLHSASAEDTPVVQLTAETPRAESKEGALNSASISLPTS
CPGSEPVPTHQQGQPAFELKEESFRDPAEVLGMGAEVDYLEQFGTSSFKESALRKQSLYL
KFDPLLRDSPRRPVPVAVETSSMHGANEPPSGSPREAKLVEFDFLGALDIPVPGPPPGVP
APGGPPLSTGPIVDLLQYSQKDLDAAVKATQEENRELRSRCEELHGKNLELGKIMDRFEE
VVYQAMAQGPSPEGEGLGCQWSQVHPTFQQHLVPAEATGVTGGGAAVRAPGSGLASLRVE
SQGCPEPPEGNEESLKKCVEDYLAKITQEGQRYQALKAHAEEKLQLANEEIAQVRSKAQA
EVLALQASLRKEQMRIQSLEKTVEQKTKENEELTRICDDLISKMEKI
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgcaggtcttaaacgacaaaaatgtcagcagtgaaaaaagtacagaaaattgc
gacttcctgttttcctcaccagaagttaccggaagatcgtctgttcttcgtgtgtcacag
aaagaaaatgtgccacccaagaacgtggccaaagctatgaaggtgacttttcagacacct
ctgcgggatccacagacgcacaggattctaagtcctagcatggccagcaaacttgaggct
cctttggctcagggtgatacccttggactggaaaactgtcacccggtgtggacgcagaaa
gagaaccaacagctcatcaaggaagtggatgccaaaactactcatggaattctacagaaa
ccagtggaggctgacgccaacctcctgggggatgcaagcccagcctttgggagtggcagc
gccagcgagcctggcccgggtgccctggctgacctggactgctcaagttcttcccagagc
ccaggaagttctgagaaccaaatggtgtctccagaaaaagtgtctggcagccctgaacaa
gccttggaggaaaatattagttcctattccttagacagaaaaatgacacccacctttgag
accctagaagacccttccaggacagagtcccagcacaaagcagagactccacacagagcc
aaggaagaatgccggcatggtggggtctctgctcccacagcaggggccacttcgcctcct
agtgcgatccctgaggaagcctgtggaggagcacccctggggggtctgcctggtgaggcc
ctggcctgccctgtgggtatgggcacccccgtgccagcagatgacactcaggcccttccc
tgtgcacacacttcttgtcctgagagcacagccccgaccagccacctggtgactggcagg
gccatgaccctgagtcctcaggaagaagcagctgtggaccaaatggccagctcctcgagg
agcggacccataaaactagaatttgatttatctgatggcgccaccagcaaaagggcagcc
ccaccaaggagactgggagagagatctggcctcaagcctcccttgaggagagcagcagcg
aggcagcaaaaggccctgcgggaggtggaggaggacccccccatgccggcttctcggggc
tcttaccacctcgactgggacaaactggatgacccaaacttcaacccattcagaggtgac
accctgtctggtcacagagaggcccagcccccagaaagccctgagaccaggctgggccgg
ccagcgtctgaacagctgagtgctgggcctgccacggaggagccaggcacgtgtctgagc
cagcagctgcattcagcctcagcggaggacacacctgtggtgcagctgacagctgagacc
ccaagagcagagagcaaggagggagccttgaactctgccagcatctcgcttcccacaagc
tgtccgggcagtgagccagtgcccacccatcagcaggggcagcctgccttcgagctgaaa
gaggagagcttcagagaccccgctgaggttctaggcatgggcgcagaggtggattacctg
gagcagtttggaacttcctcgtttaaggagtcggccttgaggaagcagtccttgtacctc
aagttcgaccccctgctgagggacagtcctcgtagaccagtgcccgtggccgtggagacc
agcagcatgcacggtgcaaatgagcctccctcaggaagtccgcgggaagccaagcttgtg
gagttcgatttcttaggagcactggacattcctgtgccaggcccacctccaggtgtcccc
gcacctgggggcccacccctgtccaccgggcctatagtggacctgctccagtacagccag
aaggacctggatgcagcggtaaaggctacacaggaggagaaccgggagctgaggagcagg
tgtgaggagctccacgggaagaacctagagctggggaaaatcatggacaggttcgaagag
gtcgtgtaccaggccatggcacagggtccatctccagagggggaggggctgggctgtcag
tggtcccaggtgcatcccactttccagcagcacttggtgccagcagaagctacaggtgtg
acaggagggggcgcagccgtgagggcaccaggttcaggcctggcgtctctgagggtggag
agccagggctgtcctgaacctccagaggggaacgaagagtcactgaagaagtgtgtggag
gattacctggcgaagatcacccaggaaggccagaggtaccaagccctgaaggcgcatgcg
gaggagaagctgcagctggcaaacgaggagatcgcccaagtccggagcaaggcccaggcg
gaagtgttggccctccaggccagcttgaggaaggagcagatgcggatccagtcgctggag
aagacagtggagcagaagactaaagagaatgaggagctgaccaggatctgcgacgacctc
atctccaagatggagaagatctga

DBGET integrated database retrieval system