KEGG   Macaca mulatta (rhesus monkey): 713035Help
Entry
713035            CDS       T01028                                 

Gene name
BCL2L1
Definition
(RefSeq) BCL2 like 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01524  Platinum drug resistance
mcc04014  Ras signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04137  Mitophagy - animal
mcc04140  Autophagy - animal
mcc04151  PI3K-Akt signaling pathway
mcc04210  Apoptosis
mcc04215  Apoptosis - multiple species
mcc04621  NOD-like receptor signaling pathway
mcc04630  Jak-STAT signaling pathway
mcc05014  Amyotrophic lateral sclerosis (ALS)
mcc05145  Toxoplasmosis
mcc05166  HTLV-I infection
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05212  Pancreatic cancer
mcc05220  Chronic myeloid leukemia
mcc05222  Small cell lung cancer
mcc05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    713035 (BCL2L1)
   04630 Jak-STAT signaling pathway
    713035 (BCL2L1)
   04064 NF-kappa B signaling pathway
    713035 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    713035 (BCL2L1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    713035 (BCL2L1)
   04137 Mitophagy - animal
    713035 (BCL2L1)
  Cell growth and death
   04210 Apoptosis
    713035 (BCL2L1)
   04215 Apoptosis - multiple species
    713035 (BCL2L1)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    713035 (BCL2L1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    713035 (BCL2L1)
   05202 Transcriptional misregulation in cancers
    713035 (BCL2L1)
   05212 Pancreatic cancer
    713035 (BCL2L1)
   05225 Hepatocellular carcinoma
    713035 (BCL2L1)
   05220 Chronic myeloid leukemia
    713035 (BCL2L1)
   05222 Small cell lung cancer
    713035 (BCL2L1)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    713035 (BCL2L1)
  Infectious diseases
   05166 HTLV-I infection
    713035 (BCL2L1)
   05145 Toxoplasmosis
    713035 (BCL2L1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    713035 (BCL2L1)
   01524 Platinum drug resistance
    713035 (BCL2L1)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     713035 (BCL2L1)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    713035 (BCL2L1)
Transporters [BR:mcc02000]
 Other Transporters
  Pores ion channels [TC:1]
   713035 (BCL2L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2 BH4 Bcl-2_3 Nitrate_red_del
Motif
Other DBs
NCBI-GeneID: 713035
NCBI-ProteinID: NP_001247646
Ensembl: ENSMMUG00000005985
UniProt: F6UKR4
Position
10
AA seq 233 aa AA seqDB search
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLV
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcaatttagtgatgtggaagagaacaggactgaggccccagaaggg
actgaatcggagatggagacccccagtgccatcaatggcaacccatcctggcacctggtg
gacagccccgcggtgaatggagccactggccacagcagcagtttggatgcccgggaggtg
atccccatggcagcagtaaagcaagcgctgagggaggcaggcgacgagtttgaactgcgg
taccggcgggcgttcagtgacctgacatcccagctccacatcaccccagggacagcatat
cagagctttgaacaggtagtgaatgaactcttccgggatggggtaaactggggtcgcatt
gtggcctttttctccttcggcggggcactgtgcgtggaaagcgtagacaaggagatgcag
gtattggtgagtcggatcgcagcttggatggccacttacctgaatgaccacctagagcct
tggatccaggagaacggcggctgggacacttttgtggaactctatgggaacaatgcagca
gccgagagccgaaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg
gccggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system