KEGG   Macaca mulatta (rhesus monkey): 713057Help
Entry
713057            CDS       T01028                                 

Gene name
GPX3
Definition
glutathione peroxidase 3 (plasma) (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    713057 (GPX3)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    713057 (GPX3)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    713057 (GPX3)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     713057 (GPX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 226 aa AA seqDB search
MARLLQASCLLSLLLAGFLPQSRGQDKSKMDCHGGVSGTIYEYGALTIDGEEYIPFKQYI
GKYVLFVNVASYUGLTGQYIELNALQEELAPFGLVLLGFPCNQFGKQEPGENSEILPSLK
YVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIR
WNFEKFLVGPDGIPVMRWHHRTTISNVKMDILSYMRRQAALGVKRK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcccggctgctgcaggcgtcctgcctgctctccctgctcctggccggcttcctcccg
cagagccggggacaagataagtcgaagatggactgccatggtggcgtgagcggcaccatt
tacgagtatggagccctcaccattgatggggaggagtacatccccttcaagcagtacatt
ggcaaatacgtcctctttgtcaacgtggccagctactgaggcctgacgggccaatacatt
gaactgaatgcactacaagaagagcttgcaccatttggtctggtccttctcggctttccc
tgcaaccaatttggaaaacaggaaccaggcgagaactcagagatccttcccagcctcaag
tatgtccgaccaggtggaggctttgtccctaatttccagctctttgagaaaggggatgtg
aatggagagaaagagcagaaattctacactttcctaaagaactcctgtcctcccacctcg
gagctcctgggtacatctgaccgcctcttctgggaacccatgaaggtccacgacatccgc
tggaactttgagaagttcctggtggggccagatggtatacctgtcatgcgctggcaccac
cggaccacgatcagcaatgtcaagatggacatcctatcctacatgaggcggcaggcagcc
ctgggggtcaagaggaagtaa

DBGET integrated database retrieval system