KEGG   Macaca mulatta (rhesus monkey): 713117Help
Entry
713117            CDS       T01028                                 

Gene name
KAT8, MYST1
Definition
(RefSeq) lysine acetyltransferase 8
  KO
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     713117 (KAT8)
Chromosome [BR:mcc03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    713117 (KAT8)
   HAT complexes
    NSL complex
     713117 (KAT8)
    MSL complex
     713117 (KAT8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
20
AA seq 465 aa AA seqDB search
MAAQGAAAAVAAATSGVAGEGEPGPGENAAAEGTAPSPGRVSPPTPARGEPEVTVEIGET
YLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQ
KNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVD
KIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQPPGKEI
YRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVG
YFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLS
YRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPK
LVEEHLKSAQYKKPPITGGWGAAVCRGRERGVWAVGMGECWYMDC
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacagggagctgctgcggcggttgcagcggcgacttcaggggtcgcgggggag
ggcgagccagggcccggggagaatgcggccgccgaggggaccgccccatccccgggccgc
gtctctccgccgaccccggcgcgcggcgagccggaagtcacggtggagatcggagaaacg
tacctgtgccggcggccggatagcacctggcattctgctgaagtgatccagtctcgagtg
aacgaccaggagggccgagaggaattctatgtacactatgtgggctttaaccggcggctg
gacgagtgggtagacaagaaccggctggcgctgaccaagacagtgaaggatgctgtgcaa
aagaactcagagaagtacctgagtgagctcgcagagcagcctgagcgcaagatcactcgc
aaccaaaagcgcaagcatgatgagatcaaccatgtgcagaagacttatgcagagatggac
cccaccacagcggccttggagaaggagcacgaggcgatcaccaaggtgaagtatgtggac
aagatccacatcgggaactacgaaattgatgcctggtatttctcaccgttccccgaagat
tatgggaaacagcccaagctctggctctgcgagtactgcctcaagtacatgaaatacgag
aagagctaccgcttccacttgggtcagtgccagtggcggcagccccccgggaaagagatc
taccgcaagagcaacatctctgtctacgaagttgatggcaaagaccataagatttactgt
cagaacctgtgtctgctggccaagcttttcctggaccataagacactgtactttgacgtg
gagccgttcgttttttacatcctgactgaggtggaccggcagggggcccacattgtcggc
tacttctccaaggagaaggagtccccggatggaaacaacgtggcctgcatcctgaccctg
cctccctaccaacgccgtggctacgggaagttcctcattgctttcagttatgagctctcc
aagctggaaagcacggtcggctcccctgagaagccgctgtctgacctgggcaagctcagc
taccgcagctactggtcctgggtgctgctggagatcctgcgggacttccggggcacactg
tccatcaaggatctcagccagatgaccagcatcacccagaatgacatcatcagtaccctg
cagtccctcaatatggtcaagtactggaagggccagcacgtgatctgtgtcacacccaag
ctggtggaggagcacctcaaaagtgcccagtataagaaaccacccatcacaggtgggtgg
ggggctgccgtgtgtcgggggcgggaaaggggtgtgtgggcagtggggatgggggagtgt
tggtatatggactgctag

DBGET integrated database retrieval system