KEGG   Macaca mulatta (rhesus monkey): 713117Help
Entry
713117            CDS       T01028                                 

Gene name
MYST1
Definition
probable histone acetyltransferase MYST1-like
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     713117 (MYST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 392 aa AA seqDB search
MAAQGAAAAVAAATSGVAGEGEPGPGENAAAEGTAPSPGRVSPPTPARGEPEVTVEIGET
YLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQ
KNSEKYLSELAEQPERKITRNQKRKHDEINHVQKVRIPSHPGQCQWRQPPGKEIYRKSNI
SVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGYFSKEK
ESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWS
WVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPKLVEEHL
KSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacagggagctgctgcggcggttgcagcggcgacttcaggggtcgcgggggag
ggcgagccagggcccggggagaatgcggccgccgaggggaccgccccatccccgggccgc
gtctctccgccgaccccggcgcgcggcgagccggaagtcacggtggagatcggagaaacg
tacctgtgccggcggccggatagcacctggcattctgctgaagtgatccagtctcgagtg
aacgaccaggagggccgagaggaattctatgtacactatgtgggctttaaccggcggctg
gacgagtgggtagacaagaaccggctggcgctgaccaagacagtgaaggatgctgtgcaa
aagaactcagagaagtacctgagtgagctcgcagagcagcctgagcgcaagatcactcgc
aaccaaaagcgcaagcatgatgagatcaaccatgtgcagaaggtccggatcccttcccat
ccaggtcagtgccagtggcggcagccccccgggaaagagatctaccgcaagagcaacatc
tctgtctacgaagttgatggcaaagaccataagatttactgtcagaacctgtgtctgctg
gccaagcttttcctggaccataagacactgtactttgacgtggagccgttcgttttttac
atcctgactgaggtggaccggcagggggcccacattgtcggctacttctccaaggagaag
gagtccccggatggaaacaacgtggcctgcatcctgaccctgcctccctaccaacgccgt
ggctacgggaagttcctcattgctttcagttatgagctctccaagctggaaagcacggtc
ggctcccctgagaagccgctgtctgacctgggcaagctcagctaccgcagctactggtcc
tgggtgctgctggagatcctgcgggacttccggggcacactgtccatcaaggatctcagc
cagatgaccagcatcacccagaatgacatcatcagtaccctgcagtccctcaatatggtc
aagtactggaagggccagcacgtgatctgtgtcacacccaagctggtggaggagcacctc
aaaagtgcccagtataagaaaccacccatcacagtggactccgtctgcctcaagtgggca
ccccccaagcacaagcaagtcaagctctccaagaagtga

DBGET integrated database retrieval system