KEGG   Macaca mulatta (rhesus monkey): 713172Help
Entry
713172            CDS       T01028                                 

Gene name
CDKN2D
Definition
cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
Orthology
K06623  
cyclin-dependent kinase inhibitor 2D
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
FoxO signaling pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    713172 (CDKN2D)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    713172 (CDKN2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
19
AA seq 166 aa AA seqDB search
MLLEEVRSGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALEL
LKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNAPDGTGALPIHLAVQEGHT
AVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggaggaggtccgctccggcgaccggctgagtggggccgcggcccggggcgac
gtgcaggaggtgcgccgccttctgcaccgcgagctggtgcatcccgacgccctcaaccgc
ttcggcaagacggcgctgcaggtcatgatgtttggcagcaccgccatcgccctggagttg
ctgaagcaaggtgccagccccaatgtccaggacacctccggcaccagtccagtccatgac
gcagcccgcactggattcctggacaccctgaaggtcctagtggagcacggggctgatgtc
aacgcgcctgatggcaccggggcacttcctatccatctggcggtgcaagagggtcacact
gctgtggtcagctttctggcggctgaatctgatctccatcgcagggacgccaggggtctc
acacccctggaactggcactgcagagaggggctcaggacctcgtggacatcctgcagggg
cacatggtggccccgctgtga

DBGET integrated database retrieval system