KEGG   Macaca mulatta (rhesus monkey): 713190Help
Entry
713190            CDS       T01028                                 

Definition
agmatinase, mitochondrial-like
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mcc00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 216 aa AA seqDB search
DDSSFGRFGPRRIREESVMLRTVNPSTGALPFQSLMVADLGDVNVNLYNLQDSCRRIQEA
YEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVGLLHVDAHTDTADEALGEKLYHGAP
FRRCVDEGLLDCKRVAQIGIRGYSTTLDPYRYNRSQGFRVVLAEDCWMKSLVPLMAEVRQ
QMGGKPIYISFDIDALDPAYAPGTGTPEIAGLTPGQ
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gacgattcttccttcggcagattcggacctcgccgcatccgggaagaatcagtgatgctt
cggacagtcaatcctagcacgggggccctccccttccagtccctcatggttgcagaccta
ggcgatgtgaatgtcaatctttacaaccttcaggacagctgccggcgaattcaagaggcc
tatgagaaaattgtagcagctggctgtattcctctgaccttgggtggagatcacacaatc
acgtatcccatattgcaagcgatggcaaaaaagcatggtccagtggggcttctgcatgtg
gacgcgcacacggacacggccgacgaggccctaggagagaagctctaccacggggcgccc
ttccgccggtgtgtggatgagggtctcctggactgtaagcgggtggcgcagattggcatc
cggggctattccacaacgttggatccctacagatacaaccggagccagggcttccgagta
gttctggctgaagactgctggatgaagtcactggttcctctgatggcagaagtcaggcag
cagatgggaggcaaacccatttatatcagctttgatattgacgctctggatcctgcctat
gccccagggacagggacacctgaaattgctggtctcactcctggtcag

DBGET integrated database retrieval system