KEGG   Macaca mulatta (rhesus monkey): 713242Help
Entry
713242            CDS       T01028                                 

Gene name
PBK
Definition
PDZ binding kinase
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     713242 (PBK)
Protein kinases [BR:mcc01001]
 Serine/threonine protein kinases: Other group
  TOPK family
   713242 (PBK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 323 aa AA seqDB search
MEGISNFKTPCKLSEKKKSVLNSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSP
WAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEASDGSLCLAMEYGGE
KSLNDLIEERYKASRDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFE
TIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEALEENGVITDKADIFAFGLTLWEM
MTLSIPHVNLSNDDDDDEDKTFDESDFDDEAYYAALGTRPPINMDELNESYQKVIELFSV
CTNEDPKDRPSAAHIVGALETDV
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggaagggatcagtaatttcaagacaccatgcaaattatcagaaaaaaagaaatctgta
ttaaattcaactccaactataaatatccctgcctctccatttatgcagaagcttggcttt
ggtactggggtaaatgtttaccttatgaaaagatctccaagaggtttgtctcattctcct
tgggctgtaaaaaagattaatcctatatgtaatgatcattatcgaagtgtgtatcaaaag
agactaatggatgaagctaagattttgaaaagccttcatcatccaaacattgttggttat
cgtgcttttactgaagccagtgatggcagtctgtgtcttgctatggaatatggaggtgaa
aagtctctaaatgacttaatagaagaacgatataaagccagccgagatccttttccagca
gccataattttaaaagttgctttgaatatggcaagagggttaaagtatctgcaccaagaa
aagaaattgcttcatggagacataaagtcttcaaatgttgtaattaaaggagattttgaa
acaattaaaatctgtgatgtaggagtctctctaccactggatgaaaatatgactgtgact
gaccctgaggcttgttacattggcacagagccatggaaacccaaagaagctttggaggag
aatggtgttattactgacaaggcagacatatttgcctttggccttactctgtgggaaatg
atgactttatcgattccacacgttaatctttcaaatgatgatgatgatgatgaagataaa
acttttgatgaaagtgattttgatgatgaagcatactatgcagccctgggaactaggcca
cctattaatatggacgaactcaatgaatcataccagaaagtaattgaactcttttctgta
tgcactaatgaagaccctaaagatcgtccttctgctgcccacattgttggagctctggaa
acagatgtctag

DBGET integrated database retrieval system