KEGG   Macaca mulatta (rhesus monkey): 713253Help
Entry
713253            CDS       T01028                                 

Definition
(RefSeq) aldose 1-epimerase-like
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00010  Glycolysis / Gluconeogenesis
mcc00052  Galactose metabolism
mcc01100  Metabolic pathways
Module
mcc_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    713253
   00052 Galactose metabolism
    713253
Enzymes [BR:mcc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     713253
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 713253
NCBI-ProteinID: XP_014967632
Position
13
AA seq 213 aa AA seqDB search
MASVTRAAFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFA
ELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTP
RVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELVVNYRAQASQATPVNLTNHSYFN
LAGQGSPNIYDHEVTIEADTYLPVDETLIPIGW
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggtgaccagagccgcgtttggagagctgccctcgggaggagggacagtggaa
aagttccagctgcagtcagacctcctgagagtggacatcatctcctggggctgcacgatc
acagccctagaggtcaaagacaggcaggggagagcctcagacgtggtgcttggcttcgcg
gagttggaaggatacctccaaaagcagccatactttggagcagttattgggagggtggcc
aaccgaatcgccaaaggaaccttcaaggtggatgggaaggagtatcacctggccattaac
aaggaacccaacagtctgcatggaggagtcagagggtttgataaggtactctggacccct
cgggtgctgtccaatggcgtccagttctcgcgcatcagtccagatggtgaggaaggctac
cccggagagttaaaagtctgggtgacatacaccctggatggcggggagcttgtggtcaac
tatagagcacaggccagtcaggccacaccagtcaacctgaccaaccattcttacttcaac
ctggcaggccagggttccccgaatatatatgaccatgaagtcaccatagaagcggatact
tacttgcctgtggatgaaaccctgattcctataggttggtga

DBGET integrated database retrieval system