KEGG   Macaca mulatta (rhesus monkey): 713370Help
Entry
713370            CDS       T01028                                 

Gene name
ACHE
Definition
acetylcholinesterase (EC:3.1.1.7)
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycerophospholipid metabolism
Cholinergic synapse
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:mcc00564]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:mcc04725]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 614 aa AA seqDB search
MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPV
SAFLGIPFAEPPTGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPN
RELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSM
NYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASV
GMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTEL
VACLRTRPAQVLVNNEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVG
VVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPE
DPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGY
EIEFIFGIPLDPSRNYTTEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQ
YVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN
QFDHYSKQDRCSDL
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaggcccccgcagtgtctgctgcacacgccttccctggcttccccactccttctcctc
ctcctctggctcctgggaggaggagtgggggctgagggccgggaggatgcagagctgctg
gtgactgtgcgtgggggccggctgcggggcattcgtctgaagacccccgggggccccgtc
tctgctttcctgggcatcccctttgcggagccacccacaggacctcgtcgctttctgcca
ccggagcccaagcagccttggtcaggggtggtagatgctacaaccttccagagtgtctgc
taccagtatgtggacaccctatacccaggttttgagggcaccgagatgtggaaccccaac
cgtgagctgagcgaggactgcctgtacctcaacgtgtggacaccatacccccggcctaca
tcccccacccctgttctcgtctggatctatgggggtggcttctacagtggggcctcctcc
ttagacgtgtatgatggccgcttcttggtacaggccgagaggactgtgctggtgtccatg
aactaccgggtgggagcctttggcttcctggccctgcccgggagccgagaggccccgggg
aatgtgggtctcctggatcagaggctggccctgcagtgggtgcaggagaacgtggcagcc
ttcgggggtgacccgacatcagtgacgctgtttggggagagtgcgggtgctgcctcagtg
ggcatgcatctgctgtccccgcccagccggggtctgttccacagggccgtgctgcaaagc
ggtgcccccaatggaccctgggccacggtgggcatgggagaggcccgccgcagggccaca
cagctggcccaccttgtgggctgtcccccaggcggcactggtgggaatgacacagagcta
gtagcctgccttcggacacgaccagcgcaggtcctggtgaacaatgaatggcatgtgctg
cctcaagaaagcgtcttccggttctccttcgtacctgtggtagatggagacttcctcagt
gacaccccagaggcccttatcaacgcgggagacttccacggcctgcaggtgctggtgggt
gtggtgaaggatgagggctcatattttctggtttacggggccccaggcttcagcaaagac
aacgagtctctcatcagccgggccgagttcctggccggggtgcgggtcggggtcccccag
gtaagtgacctggcagccgaggctgtggtcctgcattacacagactggctgcatcccgag
gacccggcacgcctgagggaggccctgagcgatgtggtgggcgaccacaatgtcgtgtgc
cccgtggcccagctggctgggcgactggctgcccagggtgcccgggtctacgcctacgtc
ttcgaacaccgtgcctccacgctctcctggcccctgtggatgggggtgccccacggctac
gagatcgagttcatctttgggatccccctggacccttctcgaaactacacgacggaggag
aaaatcttcgcccagcgactgatgcgatactgggccaactttgcccgcacaggggatccc
aatgagccccgagaccccaaggccccacaatggcccccgtacacggcgggggctcagcag
tacgttagtctggacctgcggccgctggaggtgcggcgggggctgcgcgcccaggcctgc
gccttctggaaccgcttcctccccaaattgctcagcgccaccgacacgctcgacgaggcg
gagcgccagtggaaggccgagttccaccgctggagctcctacatggtgcactggaagaac
cagttcgaccactacagcaagcaggatcgctgctcagacctgtga

DBGET integrated database retrieval system