KEGG   Macaca mulatta (rhesus monkey): 713460Help
Entry
713460            CDS       T01028                                 

Definition
uncharacterized LOC713460
Orthology
K05759  
profilin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    713460
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    713460
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    713460
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   713460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 418 aa AA seqDB search
MKDRRSSARCLSATDACSDFRLPARARGSAFMGEAQKGSRKEGALRGSEISAQDSASRAA
DTEEKHIAARPRGSKASLRLLFLGCRERRGGHPSPPARGPKIRHPPQRHRARPAPAARGG
RDCPGAVSLRAPASVSPRPSRDPPCQGAAEGSHARARARPAVSAENGGRCGKEQPPPPPP
AQPLRSLPPLVSQPRGCGRPGGRARSEVRPSSLNPRPPSAAPRGGGRSVPAQSRLLPAPA
PPSPAPPPPPPPPPATAAAAAAAPAAPRRPRCSAKGSKMAGWQSYVDNLMCDGCCQEAAI
VGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDG
DCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVHGGTLNKKAYELALYLRRSDV
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatcggcgaagctcagcaaggtgcctgagcgccacggacgcctgctctgatttc
aggttgccggcgcgcgcccgcgggtctgcctttatgggcgaggcgcaaaagggctccagg
aaagagggcgcccttaggggctcggagattagcgctcaagattccgcatcccgggcagcg
gacacagaagaaaagcacatcgcggcccggccgcggggctccaaggcgtccctgcggctg
ctgttcctagggtgccgagagcgacgcgggggccacccctctccgccggcccggggtccg
aagatccgccatccgccgcaacgccaccgcgcccggccggcgcctgccgcacgtggcggc
cgtgattgtcccggggcggtatccctccgcgcccccgcctcagtctccccccgcccttcc
cgggaccctccgtgccagggcgccgcggaaggatcgcacgcacgcgcgcgcgcacgcccc
gccgtatccgcggagaacggagggcgctgcggtaaggagcagccgccgccaccaccaccg
gcacagccgctccgcagcctcccgccgctggttagtcagccccgcggctgcgggcggccg
ggtggccgggcgcgctctgaggttcgtccctcatcgctgaacccgcgtcctccctccgcg
gctccccggggaggggggcggtcggtgcctgcgcagagccgcctcctccccgcccccgcc
ccgccttcccccgcgccgccgccgccgccgccgccgccgcccgctaccgccgccgccgcc
gccgccgcgcctgctgctcctcgccgtccgcgctgcagtgcgaagggctcgaagatggcc
ggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggccgccatt
gtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtctttcagagc
attacgccaatagaaatagatatgattgtaggaaaagaccgggaaggtttctttaccaac
ggtttgactcttggcgcgaagaaatgctcagtgatcagagatagtctatacgtcgatggt
gactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaatgttgct
gtcggcagagctggtagagcattggttatagtcatgggaaaggaaggtgtccacggaggc
acacttaacaagaaagcatatgaactcgctttatacctgaggaggtctgatgtgtaa

DBGET integrated database retrieval system