KEGG   Macaca mulatta (rhesus monkey): 713460Help
Entry
713460            CDS       T01028                                 

Gene name
PFN2
Definition
(RefSeq) profilin 2
  KO
K05759  
profilin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    713460 (PFN2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    713460 (PFN2)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    713460 (PFN2)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     713460 (PFN2)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   713460 (PFN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
2
AA seq 156 aa AA seqDB search
MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFF
TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRDVKSNKQQREYQ
EEFLHYRGFFCVEMSYDFRFGGCVGRLKSANWGPPT
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc
gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttt
cagagcattacgccaatagaaatagatatgattgtaggaaaagaccgggaaggtttcttt
accaacggtttgactcttggcgcgaagaaatgctcagtgatcagagatagtctatacgtc
gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaat
gttgctgtcggcagagctggtagagatgtgaaatctaataaacagcaaagggagtaccaa
gaagagtttctgcactatcgtggatttttctgtgttgaaatgtcgtatgactttagattt
ggaggctgtgttggcagactgaagtcagccaactggggccctcctacataa

DBGET integrated database retrieval system