KEGG   Macaca mulatta (rhesus monkey): 713683Help
Entry
713683            CDS       T01028                                 

Definition
arachidonate 12-lipoxygenase, epidermal-type-like
Orthology
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    713683
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    713683
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    713683
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     713683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 661 aa AA seqDB search
MGKYTVRVATGNLFLAGSPNLVQLWLVGEHGEADLGTQLRPVWGKVEFEIDVPLHLGRLL
MVKLRKHNGLLSVDWFCKWISVQGPGTQGEVFFPCYRWVQGHGSICLPEGTARTLSDDPQ
NLFKKYREQELEERRKVYRWGSWKDGLILPIAGNRQPDLPRDERFLEDKDLDFSVSLAKA
LKDMAIKGTLDFINCVKRLEDFKKIFPRGKTALAERVHDSWKNDALFGYQFLNGANPMLL
RRSSRLPARLVLPPGMEDLKTQLEKELQAGSLFEVDFSLLDGVKPNVIIFKPQYVAAPLV
MLKLQPDGRLLPMVIQLQPPRYGCPPPLLFLPSDPPMAWLLAKTWVRSSDFQLHQLQSHL
LRGHLIAEVIAVATMRSLPSLHPIYKLLIPHFRYTMAINTLARSRLVSEGGIFDLVVSTG
SGGHVDILQRATACLTYRSLCPPDDLADRGLLGVKSSLYGQDAIRLWGIISRYVEGMVGL
FYKSDQAVKDDLELQAWCREMTETGLQMAQDRGFPISLESRAQLCHFVTMCIFTCTGQHA
SNHLGQLDWYSWIPNGPCTMRKPPPISKDVTEKDIVDSLPNLHQAHMQKTVTDFLGRRQP
VMVALGQHEEKYFSGPEPQAVLRQFREELAAMDKEIEVRNAVLDLPYEYLRPSMVENSVT
I
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagtacacggtccgtgtagccactgggaatttgttcctggcaggctctcccaac
ctggtgcagctgtggctggtgggtgagcacggggaggcagacctagggacgcagctgcga
ccggtgtggggaaaggtggagtttgagatcgacgtccccctgcacctggggcgcctcctg
atggtgaagctgcgcaagcacaacgggctgttgagtgtcgactggttctgcaagtggatc
tcagtgcagggcccgggaacccaaggcgaggtttttttcccctgctaccgctgggtgcag
ggccacgggagtatctgcctgcccgagggcactgcccggaccctgagtgatgacccccag
aacctgtttaagaagtaccgggaacaggagctcgaagaaagaaggaaggtgtaccggtgg
ggctcctggaaagatgggttaatcctgcctatagcagggaatagacaaccggaccttccc
agggacgagcgattcctcgaggataaggatttagactttagtgtctccctagcaaaagcg
ttgaaggacatggccattaaggggacactggatttcataaattgtgtgaaaaggctggaa
gatttcaaaaaaatattcccacgtggaaagactgccctggctgagcgggttcatgattct
tggaagaatgatgccctctttgggtaccagtttctcaatggtgcaaaccccatgctcctg
aggcgttcttcaaggctccccgcccgcctggtgctgcctccagggatggaagacttgaag
acccagctggagaaagaactccaggctggatctctgtttgaagtggatttctccttgctg
gatggagtcaagcctaatgtcatcatttttaagccgcaatatgtggccgcccctttggtc
atgctgaagcttcagcctgatggaagactcttgcccatggtcatccagctccagccacct
cgatacggatgtcccccacctctgctctttctgccctcggatccccccatggcctggctc
ctggccaagacctgggtccggagctctgatttccagctgcaccagttacagtcacatctg
ctgaggggacacttgattgctgaggttatcgctgtggctacaatgagaagcttgcctagc
ctccatcctatttacaagctcctgatcccccacttccgctacaccatggcgatcaacacc
ctggcccgtagtcgtcttgtctctgaagggggaatttttgacctggtggtgagcactggt
agtgggggccacgtggacattcttcagagagccacagcttgtttgacctatcgttccctc
tgtcctcctgatgacctggctgaccgtggactcctgggtgtgaaatcttctctttatggc
caagatgccatcaggctgtggggaatcatcagccggtacgtggaggggatggttgggctt
ttctacaagagcgaccaagccgtgaaggatgatctagagctgcaggcctggtgcagagag
atgactgagactggactgcagatggcccaagaccgggggttccccatctccttagagtcc
cgggctcagctctgccactttgtcaccatgtgcatcttcacatgcacgggtcagcatgct
tctaaccacctgggtcagctggactggtactcctggatccctaatggcccatgcaccatg
cggaagcccccacccatctccaaggatgtgacagagaaggacatagtggactcactgccc
aatctccaccaggcacatatgcaaaagaccgtcacagactttcttggcagacgtcagcct
gtcatggtggccctggggcagcatgaggagaaatatttctctggccctgagccccaagct
gtgctgagacaattccgggaggagctggctgccatggacaaggagattgaggtccggaat
gcagtcctggacctgccctatgaataccttcgacccagcatggtagagaacagcgtgacc
atctga

DBGET integrated database retrieval system