KEGG   Macaca mulatta (rhesus monkey): 713683Help
Entry
713683            CDS       T01028                                 

Definition
(RefSeq) arachidonate 12-lipoxygenase, epidermal-type-like
  KO
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Antifolate resistance
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    713683
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    713683
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    713683
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    713683
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     713683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
16
AA seq 661 aa AA seqDB search
MGKYTVRVATGNLFLAGSPNLVQLWLVGEHGEADLGTQLRPVWGKVEFEIDVPLHLGRLL
MVKLRKHNGLLSVDWFCKWISVQGPGTQGEVFFPCYRWVQGHGSICLPEGTARTLSDDPQ
NLFKKYREQELEERRKVYRWGSWKDGLILPIAGNRQPDLPRDERFLEDKDLDFSVSLAKA
LKDMAIKGTLDFINCVKRLEDFKKIFPRGKTALAERVHDSWKNDALFGYQFLNGANPMLL
RRSSRLPARLVLPPGMEDLKTQLEKELQAGSLFEVDFSLLDGVKPNVIIFKPQYVAAPLV
MLKLQPDGRLLPMVIQLQPPRYGCPPPLLFLPSDPPMAWLLAKTWVRSSDFQLHQLQSHL
LRGHLIAEVIAVATMRSLPSLHPIYKLLIPHFRYTMAINTLARSRLVSEGGIFDLVVSTG
SGGHVDILQRATACLTYRSLCPPDDLADRGLLGVKSSLYGQDAIRLWGIISRYVEGMVGL
FYKSDQAVKDDLELQAWCREMTETGLQMAQDRGFPISLESRAQLCHFVTMCIFTCTGQHA
SNHLGQLDWYSWIPNGPCTMRKPPPISKDVTEKDIVDSLPNLHQAHMQKTVTDFLGRRQP
VMVALGQHEEKYFSGPEPQAVLRQFREELAAMDKEIEVRNAVLDLPYEYLRPSMVENSVT
I
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagtacacggtccgtgtagccactgggaatttgttcctggcaggctctcccaac
ctggtgcagctgtggctggtgggtgagcacggggaggcagacctagggacgcagctgcga
ccggtgtggggaaaggtggagtttgagatcgacgtccccctgcacctggggcgcctcctg
atggtgaagctgcgcaagcacaacgggctgttgagtgtcgactggttctgcaagtggatc
tcagtgcagggcccgggaacccaaggcgaggtttttttcccctgctaccgctgggtgcag
ggccacgggagtatctgcctgcccgagggcactgcccggaccctgagtgatgacccccag
aacctgtttaagaagtaccgggaacaggagctcgaagaaagaaggaaggtgtaccggtgg
ggctcctggaaagatgggttaatcctgcctatagcagggaatagacaaccggaccttccc
agggacgagcgattcctcgaggataaggatttagactttagtgtctccctagcaaaagcg
ttgaaggacatggccattaaggggacactggatttcataaattgtgtgaaaaggctggaa
gatttcaaaaaaatattcccacgtggaaagactgccctggctgagcgggttcatgattct
tggaagaatgatgccctctttgggtaccagtttctcaatggtgcaaaccccatgctcctg
aggcgttcttcaaggctccccgcccgcctggtgctgcctccagggatggaagacttgaag
acccagctggagaaagaactccaggctggatctctgtttgaagtggatttctccttgctg
gatggagtcaagcctaatgtcatcatttttaagccgcaatatgtggccgcccctttggtc
atgctgaagcttcagcctgatggaagactcttgcccatggtcatccagctccagccacct
cgatacggatgtcccccacctctgctctttctgccctcggatccccccatggcctggctc
ctggccaagacctgggtccggagctctgatttccagctgcaccagttacagtcacatctg
ctgaggggacacttgattgctgaggttatcgctgtggctacaatgagaagcttgcctagc
ctccatcctatttacaagctcctgatcccccacttccgctacaccatggcgatcaacacc
ctggcccgtagtcgtcttgtctctgaagggggaatttttgacctggtggtgagcactggt
agtgggggccacgtggacattcttcagagagccacagcttgtttgacctatcgttccctc
tgtcctcctgatgacctggctgaccgtggactcctgggtgtgaaatcttctctttatggc
caagatgccatcaggctgtggggaatcatcagccggtacgtggaggggatggttgggctt
ttctacaagagcgaccaagccgtgaaggatgatctagagctgcaggcctggtgcagagag
atgactgagactggactgcagatggcccaagaccgggggttccccatctccttagagtcc
cgggctcagctctgccactttgtcaccatgtgcatcttcacatgcacgggtcagcatgct
tctaaccacctgggtcagctggactggtactcctggatccctaatggcccatgcaccatg
cggaagcccccacccatctccaaggatgtgacagagaaggacatagtggactcactgccc
aatctccaccaggcacatatgcaaaagaccgtcacagactttcttggcagacgtcagcct
gtcatggtggccctggggcagcatgaggagaaatatttctctggccctgagccccaagct
gtgctgagacaattccgggaggagctggctgccatggacaaggagattgaggtccggaat
gcagtcctggacctgccctatgaataccttcgacccagcatggtagagaacagcgtgacc
atctga

DBGET integrated database retrieval system