KEGG   Macaca mulatta (rhesus monkey): 713748Help
Entry
713748            CDS       T01028                                 

Gene name
ALOX12
Definition
(RefSeq) arachidonate 12-lipoxygenase, 12S type
  KO
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Antifolate resistance
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    713748 (ALOX12)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    713748 (ALOX12)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    713748 (ALOX12)
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    713748 (ALOX12)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     713748 (ALOX12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
16
AA seq 663 aa AA seqDB search
MGRYRIRVATGAWLFSGSHNRVQLWLVGARGEAELELQLRPARGEEEEFDRDVAEDLGLL
QFVRLRKHHWLVDDAWFCDRITVQGPGACAEAAFPCYRWVQGEDILSLPEGTARLPGDNA
LDVFQKHREKELKDRQQIYCWATWKEGLPLTIAAERKDDLPPNMRFHEEKRLDFEWTLKA
GALEMALKRVYTLLSSWNCLEDFDQIFWGQKSVLAEKVHRCWQDDELFAYQFVNGANPML
LRRSTSLPSRLALPSGMEELRAQLEKELQNGSLFEADFILLDGIPANVIRGEKQYLAAPL
VMLKMEPNGKLLPMVIQIQPPNPSSPTPTLFLPSDPPLAWLLAKSWVRNSDFQLHQLQYH
LLNTHLVAEVIAVATMRCLPGLHPIFKLLIPHIRYTMEINTRARTQLISDGGIFDKAVST
GGGGHVQLLRRATAQLTYCSLCPPDDLADRGLLGLPGALYARDALRLWEIIARYVEGIVH
LFYQRDDVVRGDPELQAWCREITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCVFTCTAQH
AAINQGQLDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVQQACLQMAISWHLGRR
QPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLENLEKEITARNEQLDWPYEYLKPSCIENS
VTI
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgggccgctaccgcatccgcgtggccaccggggcctggctcttctccgggtcgcacaac
cgcgtgcagctttggctggtcggggcgcgcggggaggcggagctggagctgcagctgcgg
ccggcgcggggagaggaggaggagtttgatcgtgacgttgcagaggacttggggctcctg
cagttcgtgaggctgcgcaaacaccactggctggtggacgacgcatggttctgcgaccgc
atcacggtgcagggccctggagcctgcgcggaggcggccttcccgtgctaccgctgggtg
cagggcgaggacatcctgagcctgcccgagggcaccgcccgcctgccaggagacaacgcc
ttggatgtgttccagaagcatcgagagaaggaactgaaagacagacagcagatctactgc
tgggccacctggaaggaagggttacccctgaccatcgctgcagagcgtaaggatgaccta
cctccaaatatgagattccatgaggagaagaggctggactttgaatggacactgaaggca
ggggctctggagatggccctcaaacgtgtttacaccctcctgagctcctggaactgccta
gaagactttgatcagatcttctggggccagaagagtgtcctggctgagaaggttcaccgg
tgctggcaggatgatgagctgttcgcctaccagttcgtcaatggtgccaaccccatgctg
ttgagacgctcgacctctctgccctccaggctagcgctgccctcggggatggaagagctt
cgtgctcaactggagaaagaacttcagaatggttccctgtttgaagctgacttcatcctt
ctggatggaattccagccaacgtgatccgaggagagaagcagtacctggctgcccccctc
gtcatgctgaagatggagcctaacgggaaactgctgcccatggtcatccagattcagcct
cccaaccccagctctccaaccccaacactgttcctgccctcggaccccccacttgcctgg
ctcctggcaaagtcctgggtccgaaattcagatttccaactgcaccagctccagtaccac
ctgctgaacacacatctggtggctgaggtcatcgctgtcgccaccatgcggtgcctccca
ggactgcaccccatcttcaagctcctgatcccccatatccgctacaccatggaaatcaac
acccgggcccggacccaactcatctcagatggaggaatttttgataaggcggtgagcaca
ggtggagggggccatgtgcagttgcttcgtcgggcgacggctcagctgacctactgctcc
ctctgtcctcctgacgacctggctgaccggggcctgctgggactcccaggtgctctctac
gcccgtgatgctttacggctctgggagatcattgccaggtatgtggaggggatcgtccac
ctcttctaccaaagggatgacgtagtgaggggggaccctgagctgcaggcctggtgtcgg
gagatcacagaggtggggctgtgccaggcccaggaccgaggtttccctgtctccttccag
tcccagagtcaactctgccatttcctcaccatgtgcgtcttcacgtgcactgcccagcat
gccgccatcaaccagggccagctggactggtatgcctgggtccctaatgccccatgcaca
atgcggatgcctccacccaccaccaaggaagacgtgacaatggccacagtgatgggatca
ctacctgatgtccagcaggcctgtcttcaaatggccatctcatggcatctgggtcgccgc
cagccagacatggtgcctctggggcatcacaaagaaaaatatttctcaggccccaagccc
aaagcggtgctaaaccaattccgaacagatttggaaaacctggaaaaggagattacagcc
cggaatgagcaacttgactggccctatgaatacctgaagcccagctgcatagagaacagt
gtcaccatctga

DBGET integrated database retrieval system