KEGG   Macaca mulatta (rhesus monkey): 713777Help
Entry
713777            CDS       T01028                                 

Gene name
SOS1
Definition
son of sevenless homolog 1 (Drosophila)
Orthology
K03099  
son of sevenless
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Chemokine signaling pathway
FoxO signaling pathway
PI3K-Akt signaling pathway
Dorso-ventral axis formation
Focal adhesion
Gap junction
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Neurotrophin signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Estrogen signaling pathway
Prolactin signaling pathway
Alcoholism
Hepatitis C
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Renal cell carcinoma
Endometrial cancer
Glioma
Prostate cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    713777 (SOS1)
   04010 MAPK signaling pathway
    713777 (SOS1)
   04012 ErbB signaling pathway
    713777 (SOS1)
   04630 Jak-STAT signaling pathway
    713777 (SOS1)
   04068 FoxO signaling pathway
    713777 (SOS1)
   04151 PI3K-Akt signaling pathway
    713777 (SOS1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    713777 (SOS1)
  Cellular commiunity
   04510 Focal adhesion
    713777 (SOS1)
   04540 Gap junction
    713777 (SOS1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    713777 (SOS1)
   04660 T cell receptor signaling pathway
    713777 (SOS1)
   04662 B cell receptor signaling pathway
    713777 (SOS1)
   04664 Fc epsilon RI signaling pathway
    713777 (SOS1)
   04062 Chemokine signaling pathway
    713777 (SOS1)
  Endocrine system
   04910 Insulin signaling pathway
    713777 (SOS1)
   04912 GnRH signaling pathway
    713777 (SOS1)
   04915 Estrogen signaling pathway
    713777 (SOS1)
   04917 Prolactin signaling pathway
    713777 (SOS1)
  Nervous system
   04722 Neurotrophin signaling pathway
    713777 (SOS1)
  Development
   04320 Dorso-ventral axis formation
    713777 (SOS1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    713777 (SOS1)
   05206 MicroRNAs in cancer
    713777 (SOS1)
   05205 Proteoglycans in cancer
    713777 (SOS1)
   05214 Glioma
    713777 (SOS1)
   05221 Acute myeloid leukemia
    713777 (SOS1)
   05220 Chronic myeloid leukemia
    713777 (SOS1)
   05211 Renal cell carcinoma
    713777 (SOS1)
   05215 Prostate cancer
    713777 (SOS1)
   05213 Endometrial cancer
    713777 (SOS1)
   05223 Non-small cell lung cancer
    713777 (SOS1)
  Substance dependence
   05034 Alcoholism
    713777 (SOS1)
  Infectious diseases
   05160 Hepatitis C
    713777 (SOS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 1300 aa AA seqDB search
MGNSVQGQVHPTLESNDDALQYVEELILQLLNMLCQAQPRSASDVEERVQKSFPHPIDKW
AIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGYKIDHQVSVYIVAVLEYISADILKLV
GNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDVEDINILSLTDEEPSTSGEQTYYDLV
KAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSANDVENIFSRIVDIHELSVKLLGHIED
TVEMTDEGSPHPLVGSCFEDLAEELAFDPYESYARDILRPGFHDRFLSQLSKPGAALYLQ
SIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQLEEKSEDQEDKECLKQAITALLNVQS
GMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIKKMNEIQKNIDGWEGKDIGQCCNEFI
MEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRLPGASNAEYRLKEKFFMRKVQINDKD
DTNEYKHAFEIILKDENSVIFSAKSAEEKNNWMAALISLQYRSTLERMLDVTMLQEEKEE
QMRLPSADVYRFAEPDSEENIIFEENMQPKAGIPIIKAGTVIKLIERLTYHMYADPNFVR
TFLTTYRSFCKPQELLSLIIERFEIPEPEPTEADRIAIENGDQPLSAELKRFRKEYIQPV
QLRVLNVCRHWVEHHFYDFERDAYLLQRMEEFIGTVRGKAMKKWVESITKIIQRKKIARD
NGPGHNITFQSSPPTVEWHISRPGHIETFDLLTLHPIEIARQLTLLESDLYRYVGAKVIV
AFAITVNAVPRNVGNIGTELFLEICIVETENLEERVAVVSRIIEILQVFQELNNFNGVLE
VVSAMNSSPVYRLDHTFEQIPSRQKKILEEAHELSEDHYKKYLAKLRSINPPCVPFFGIY
LTNILKTEEGNPEVLKRHGKELINFSKRRKVAEITGEIQQYQNQPYCLRVESDIKRFFEN
LNPMGNSMEKEFTDYLFNKSLEIEPRNPKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHP
TPLQQEPRKISYSRIPESETESTASAPNSPRTPLTPPPASGASSTTDVCSVFDSDHSSPF
HSSNDTVFIQVTLPHGPRSASVSSISLTKGTDEVPVPPPVPPRRRPESAPAESSPSKIMS
KHLDSPPAIPPRQPTSKAYSPRYSISDRTSISDPPESPPLLPPREPVRTPDVFSSSPLHL
QPPPLGKKSDHGNAFFPNSPSPFTPPPPQTPSPHGTRRHLPSPPLTQEVDLHSIAGPPVP
PRQSTSQHIPKLPPKTYKREHTHPSMHRDGPPLLENAHSS
NT seq 3903 nt NT seq  +upstreamnt  +downstreamnt
atggggaacagtgtccaggggcaagttcatcctactctcgagtctaatgatgatgctctt
cagtatgttgaagaattaattttgcaattattaaatatgctatgtcaagctcagccccga
agtgcttcagatgtagaggaacgtgttcaaaaaagtttccctcatccaattgataagtgg
gcaatagctgatgcccaatcagctattgaaaagaggaagcgaagaaaccctttatccctc
ccagtagaaaaaatccatcctttattaaaggaggtcctaggttataaaattgaccatcag
gtttctgtttacatagtagcagtcttagaatacatttctgcagacattttaaagctggtt
gggaattatgtaagaaatatacggcattatgaaattacaaaacaagatattaaagtggca
atgtgtgctgacaaggtattgatggatatgtttcatcaagatgtagaagatattaatata
ttatctttaactgatgaagagccttccacctcaggagaacaaacttactatgatttggta
aaagcatttatggcagaaattcgacaatatataagggaactaaatctaattataaaagtt
tttagagagccctttgtctccaattcaaaattgttttcagctaatgatgtagaaaatata
tttagtcgtatagtagatatacatgaacttagtgtaaagttactgggccatatagaagat
acagtagaaatgacagatgaaggcagtccccatccactagtaggaagctgctttgaagac
ttagcagaggaactggcatttgatccatatgaatcgtatgctcgagatattttgcgacct
ggttttcatgatcgtttccttagtcagttatcaaagcctggggcagcactttatttgcag
tcaataggcgaaggtttcaaagaagctgttcaatatgttttacccaggctgcttctggcc
cctgtttaccactgtctccattactttgaacttttgaagcagttagaagaaaaaagtgaa
gatcaagaagacaaggaatgtttaaaacaagcaataacagctttgcttaatgttcagagt
ggtatggaaaaaatatgttctaaaagtcttgcaaaacgaagactgagtgaatctgcatgt
cggttttatagtcaacaaatgaaggggaaacaactagcaatcaagaaaatgaatgagatt
cagaagaatattgatggttgggagggaaaagacattggacagtgttgcaatgaatttata
atggaaggaactcttacacgtgtaggagccaaacatgagagacacatatttctctttgat
ggcttaatgatttgctgtaaatcaaatcatgggcagccaagacttcctggtgctagcaat
gcagaatatcgtcttaaagaaaagttttttatgcgaaaggtacaaattaatgataaagat
gacaccaatgaatacaagcatgcttttgaaataattttaaaagatgaaaatagtgttata
ttttctgccaagtcagctgaagagaaaaacaattggatggcagcattgatatctttacag
taccggagtacactggaaaggatgcttgatgtaacaatgctacaggaagagaaagaggag
cagatgaggctgcctagtgctgatgtttatagatttgcggagcctgactctgaagagaat
attatatttgaagagaacatgcagcccaaggctggaattccaattatcaaagcaggaact
gttattaaacttatagagaggcttacgtaccatatgtacgcagatcccaattttgttcgg
acatttcttacaacatacagatccttttgcaaacctcaagaactactgagtcttataata
gaaaggtttgaaattccagagcctgagccaacagaagctgatcgcatagctatagagaat
ggagatcaacccttgagtgcagaactgaaaagatttagaaaagaatatatacagcctgtg
caactgcgagtattaaatgtatgtcggcactgggtagagcaccacttctatgattttgaa
agagatgcatatcttttgcaacgaatggaagaatttattggaacagtaagaggtaaagca
atgaaaaaatgggttgaatccatcactaaaataatccaaaggaaaaaaattgcaagagac
aatggaccaggtcataatattacatttcagagttcacctcccacagttgagtggcatata
agcagacctgggcacatagagactttcgacctgctcaccttacacccaatagaaattgct
cgacaactcactttacttgaatcagatctataccggtatgttggtgcaaaagtaattgtg
gcttttgccattacagttaatgctgttcctagaaatgtaggaaacataggaacagagctg
ttcctagaaatatgtattgtagaaactgaaaatttagaagaaagagtagctgtggtgagt
cgaataattgagattctacaagtctttcaagagttgaacaactttaatggtgtccttgag
gttgtcagtgctatgaattcctcacctgtttacagactagaccacacatttgagcaaata
ccaagtcgccagaagaaaattttagaagaagctcatgaattgagtgaagatcactataag
aaatatttggcaaaactcaggtctattaatccaccatgtgtgcctttctttggaatttat
ctcactaatatcttgaaaacagaagaaggcaaccctgaggtcctaaaaagacatggaaaa
gagcttataaactttagcaaaaggaggaaagtagcagaaataacaggagagatccagcag
taccaaaatcagccttactgtttacgagtagaatcagatatcaaaagattctttgaaaac
ttgaatccgatgggaaacagcatggaaaaagaatttacagattatcttttcaacaaatcc
ctagaaatagaaccacgaaaccctaagcctctcccaagatttccaaaaaaatatagctat
cccctaaaatctcctggtgttcgtccatcaaacccaagaccaggtaccatgaggcatccc
acacctctgcagcaggagccaaggaaaattagttatagtaggatccctgaaagtgaaaca
gaaagtacagcatctgcaccaaattctccaagaacaccgttaacacctccgcctgcttct
ggtgcttccagtaccacagatgtttgcagtgtatttgattccgatcattcgagccctttt
cactcaagcaatgataccgtctttatccaagttacactgccccatggcccaagatctgct
tctgtatcatctataagtttaaccaaaggcactgatgaagtgcctgtccctcctcctgtt
cctccacgaagacgaccagaatctgccccagcagaatcttcaccatctaagattatgtct
aagcatttggacagccccccagccattcctcctaggcaacccacatcaaaagcctattca
ccacgatattcaatatcagaccggacctctatctcagaccctcctgaaagccctccctta
ttaccaccacgagaacctgtgaggacacctgatgttttctcaagctcaccactacatctc
caacctccccctttgggcaaaaaaagtgaccatggcaatgccttcttcccaaacagccca
tccccctttacaccacctcctcctcaaacaccttctcctcacggcacaagaaggcatctg
ccatcaccaccattgacacaagaagtggaccttcattccattgctgggccgcctgttcct
ccacgacaaagcacttctcaacatatccctaaactccctccaaaaacttacaaaagggag
cacacacacccatccatgcacagagatggaccaccactgttggagaatgcccattcttct
tga

DBGET integrated database retrieval system