KEGG   Macaca mulatta (rhesus monkey): 713851Help
Entry
713851            CDS       T01028                                 

Gene name
CTRB1, CTRB2
Definition
(RefSeq) chymotrypsinogen B
  KO
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     713851 (CTRB1)
Peptidases [BR:mcc01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   713851 (CTRB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
20
AA seq 339 aa AA seqDB search
MAFLWILSCWALLGTAFGCGVPAIPPVLSGLTRIVNGEDAVPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVRTSNVVMAGEFDQGSDEENIQVLKIAKVPRPRAAEGRGSGHG
GRSLGCFRDRCPGGPAQPRGSHSGPGDGLLLNGHQGRSLCPRSLQVLPPPRASPWHSGPH
PQVFKNPSFSIFTVRNDITLLKLATPAVFSQTVSAVCLPSADDDFPTGTVCVTTGWGKTK
YNANKIPDKLQQAALPLLSNAQCRKFWGSKITEMICAGASGVSSCKGDSGGPLVCQKDRA
WTLMGIVSWGSGTCSTSSPGVYTHVTKLIPRVQEILAAN
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggctttcctctggatcctctcctgctgggccctcctgggcaccgccttcggctgtggg
gtccccgccatcccccccgtgctcagcggcctgaccaggatcgtcaatggggaggacgcc
gtccctggctcctggccctggcaggtgtccctgcaggacaaaaccggcttccacttctgc
ggaggttccctcatcagtgaggactgggtggtcaccgccgcccactgcggggtcaggacc
tccaatgtggtcatggccggggagtttgaccagggctctgatgaggagaacatccaggtc
ctgaagatcgccaaggtgcccaggccccgtgcagcagagggcaggggcagcgggcacggg
gggagatccctcggctgcttcagggacaggtgcccaggggggccggcccagcctcgtggt
tcccattccggccctggggatggactgctccttaatgggcaccagggaaggagtctgtgt
cctcgaagcctgcaggtcctgcctcctcccagggcctcaccctggcactctggcccccac
ccccaggtcttcaagaaccccagcttcagcattttcaccgtgcgcaatgacatcaccctg
ctgaagctggccacacccgccgtcttctcccagacggtgtccgccgtgtgcctgcccagc
gccgacgatgacttccccacggggacagtgtgcgtcaccacaggctggggcaagaccaag
tacaacgccaacaagatccctgacaagctgcagcaggcggccctgcccctcctgtccaat
gcccaatgcaggaagttctggggcagcaagatcaccgagatgatctgcgctggagccagc
ggtgtctcctcctgcaagggtgactccggcggccccctggtctgccagaaggacagagcc
tggaccctcatgggcattgtgtcctggggcagtggcacctgctccacctccagccctggc
gtgtacacccatgttaccaagctcataccccgggtgcaggagatcctggctgccaactga

DBGET integrated database retrieval system