KEGG   Macaca mulatta (rhesus monkey): 713951Help
Entry
713951            CDS       T01028                                 

Gene name
HIBCH
Definition
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    713951 (HIBCH)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    713951 (HIBCH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    713951 (HIBCH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    713951 (HIBCH)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     713951 (HIBCH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 359 aa AA seqDB search
MSKHTDAAEDVLLEKKGCAGVITLNRPKFLNALTLNMIRQIYSQLKKWEQDPETFLIIIK
GAGGKAFCAGGDIRVISEAEKAKQNIAPVFFREEYMLNNAVGSCQKPYVALIHGITMGGG
VGLSVHGQFRVATEKCLFAMPETAIGLFPDVGGGYFLPRLQGKLGYFLALTGFRLKGRDV
YRAGIATHFVDSEKLAMLEEDLLALKSPSKENIASVLENYHTESKIDRDKSFMLEEHMDK
INSCFSANTMEEIIENLKQDGSSFALEQLKVINKMSPTSLKITLRQLMEGSSKTLQEVLT
MEYRLSQACMRGHDFHEGVRAVLIDKDQSPKWKPADLKEVTDEDLNNHFKSLGSNDLKF
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcacacagatgcagcagaagatgtgctattggaaaaaaaaggttgtgcggga
gtcataacactaaacagaccaaagttcctcaatgcactgactcttaatatgattcggcag
atttattcacagctaaagaagtgggaacaagatcccgaaactttcctgatcattataaag
ggagctggaggaaaggctttctgtgctgggggtgatatcagagtgatctcggaagctgaa
aaggcaaaacagaatatagctccagttttcttcagagaagaatatatgctgaacaatgct
gttggttcttgccagaaaccttatgttgcacttattcatggaattacaatgggtggggga
gttggtctctcagtccatgggcaatttcgagtggctacagaaaagtgtctttttgctatg
ccagaaacagcaataggactgttccctgatgtgggtggaggttatttcttgccacgactt
caaggaaaacttggttacttccttgcattaacaggattcagactaaaaggaagagatgtg
tacagagcaggaattgctacacactttgtagattctgaaaagttggccatgttagaggaa
gatttgttagccttgaaatctccttcaaaagaaaatattgcatctgtcttagaaaattac
catacagagtctaagattgatcgagacaagtcttttatgcttgaggaacacatggacaaa
ataaacagttgtttttcagccaataccatggaagaaattattgaaaacttaaagcaagat
ggttcatcttttgccctagagcaattgaaggtaattaataaaatgtctccaacatctttg
aagatcacactaaggcaactcatggaggggtcttcaaagaccttgcaagaagtactaact
atggagtatcggctaagtcaagcttgtatgagaggtcatgactttcatgaaggcgttaga
gctgttttaattgataaagaccagagtccaaaatggaaaccagctgatctaaaagaagtt
actgatgaagatttgaataatcactttaagtctttgggaagcaatgatttgaaattttga

DBGET integrated database retrieval system