KEGG   Macaca mulatta (rhesus monkey): 713951Help
Entry
713951            CDS       T01028                                 

Definition
3-hydroxyisobutyryl-CoA hydrolase, mitochondrial-like
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    713951
  Carbohydrate metabolism
   00640 Propanoate metabolism
    713951
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    713951
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    713951
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     713951
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 444 aa AA seqDB search
MSRSQLKTKLQRKRSLWLSGGLVICAQRGRTAVGGAHARRWKGPRDSRYVALALECLAMG
QREVWRLMSRFNAFKRTNTILHHLRMSKHTDAAEDVLLEKKGCAGVITLNRPKFLNALTL
NMIRQIYSQLKKWEQDPETFLIIIKGAGGKAFCAGGDIRVISEAEKAKQNIAPVFFREEY
MLNNAVGSCQKPYVALIHGITMGGGVGLSVHGQFRVATEKCLFAMPETAIGLFPDVGGGY
FLPRLQGKLGYFLALTGFRLKGRDVYRAGIATHFVDSEKLAMLEEDLLALKSPSKENIAS
VLENYHTESKIDRDKSFMLEEHMDKINSCFSANTMEEIIENLKQDGSSFALEQLKVINKM
SPTSLKITLRQLMEGSSKTLQEVLTMEYRLSQACMRGHDFHEGVRAVLIDKDQSPKWKPA
DLKEVTDEDLNNHFKSLGSNDLKF
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtagccagttaaaaaccaaattgcagcggaaacggtcgctctggctttctgga
ggacttgtcatctgtgcccagcggggccggacggcggtgggcggggctcacgcgaggcgc
tggaagggtccgcgtgattctcgctacgttgctttagctctggagtgtttggcgatgggg
cagcgggaggtgtggaggctcatgtcgaggtttaatgcattcaaaaggactaataccata
ctgcaccatttgagaatgtccaagcacacagatgcagcagaagatgtgctattggaaaaa
aaaggttgtgcgggagtcataacactaaacagaccaaagttcctcaatgcactgactctt
aatatgattcggcagatttattcacagctaaagaagtgggaacaagatcccgaaactttc
ctgatcattataaagggagctggaggaaaggctttctgtgctgggggtgatatcagagtg
atctcggaagctgaaaaggcaaaacagaatatagctccagttttcttcagagaagaatat
atgctgaacaatgctgttggttcttgccagaaaccttatgttgcacttattcatggaatt
acaatgggtgggggagttggtctctcagtccatgggcaatttcgagtggctacagaaaag
tgtctttttgctatgccagaaacagcaataggactgttccctgatgtgggtggaggttat
ttcttgccacgacttcaaggaaaacttggttacttccttgcattaacaggattcagacta
aaaggaagagatgtgtacagagcaggaattgctacacactttgtagattctgaaaagttg
gccatgttagaggaagatttgttagccttgaaatctccttcaaaagaaaatattgcatct
gtcttagaaaattaccatacagagtctaagattgatcgagacaagtcttttatgcttgag
gaacacatggacaaaataaacagttgtttttcagccaataccatggaagaaattattgaa
aacttaaagcaagatggttcatcttttgccctagagcaattgaaggtaattaataaaatg
tctccaacatctttgaagatcacactaaggcaactcatggaggggtcttcaaagaccttg
caagaagtactaactatggagtatcggctaagtcaagcttgtatgagaggtcatgacttt
catgaaggcgttagagctgttttaattgataaagaccagagtccaaaatggaaaccagct
gatctaaaagaagttactgatgaagatttgaataatcactttaagtctttgggaagcaat
gatttgaaattttga

DBGET integrated database retrieval system