KEGG   Macaca mulatta (rhesus monkey): 714004Help
Entry
714004            CDS       T01028                                 

Definition
uricase-like
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    714004
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    714004
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     714004
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 301 aa AA seqDB search
MPVFSLQNDELEFVRTGYGKDMVKVLHIQRDGKYHSIKEVATSVQLTLSSKKDYVHGDNS
DIIPTDTIKNTVHVLAKLKGIKSIEAFGVNICEYFLSSFNHVIRAQVYVEEIPWKRLEKN
GVKHVHAFIHTPTGTHFCEVEQLRSGPPVIHSGIKDLKVLKTTQSGFEGFIKDQFTTLPE
VKDRCFATQVYCKWRYHQCRDVDFEATWGTIRDLVLEKFAGPYDKGEYSPSVQKTLYDIQ
VLSLSRVPEIEDMEISLPNIHYFNIDMSKMGLINKEEVLLPLDNPYGKITGTVKRKLSSR
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtgttttcattgcagaatgatgagttggagtttgtccgaactggctatgggaag
gatatggtaaaagttctccatattcagcgagatggaaaatatcacagcattaaagaggtg
gcaacttcagtgcaacttactctgagttccaaaaaagattacgtgcatggagataattca
gatatcatccctacagacaccatcaagaacacagttcatgtcttggcaaagttgaaggga
atcaaaagcatagaagcctttggtgtgaatatttgtgagtattttctttcttcttttaac
catgtaatccgagctcaagtctacgtggaagaaatcccctggaagcgtcttgaaaagaat
ggagttaagcatgtccatgcatttattcacactcccactggaacacacttctgtgaagtt
gaacaactgagaagtggaccccccgtcattcattctggaatcaaagacctcaaggtcttg
aaaacaacacagtctggatttgaaggtttcatcaaggaccagttcaccaccctccctgag
gtgaaggaccgatgctttgccacccaagtgtactgcaagtggcgctaccaccagtgcagg
gatgtggacttcgaggctacctggggcaccattcgggaccttgtcctggagaaatttgct
gggccctatgacaaaggcgagtactcgccctctgtgcagaagaccctctatgatatacag
gtgctctccctgagccgagttcctgagatagaagatatggaaatcagcctgccaaacatt
cactacttcaatatagacatgtccaaaatgggtctgatcaacaaggaagaggtcttgctg
ccattagacaatccatatggaaaaattactggtacagtcaagaggaagttgtcttcaaga
ctgtga

DBGET integrated database retrieval system