KEGG   Macaca mulatta (rhesus monkey): 714032Help
Entry
714032            CDS       T01028                                 

Gene name
USP5
Definition
ubiquitin specific peptidase 5 (isopeptidase T) (EC:3.4.19.12)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     714032 (USP5)
Peptidases [BR:mcc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   714032 (USP5)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   714032 (USP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
11
AA seq 835 aa AA seqDB search
MAELSEEALLSVLPTIRVPKAGDRVHKDECAFSFDTPESEGGLYICMNTFLGFGKQYVER
HFNKTGQRVYLHLRRTRRLKEEDPATGTGDPPRKKPTRLAIGVEGGFDLSEEKFELDEDV
KIVILPDYLEIARDGLGGLPDIVRDRVTSAVEALLSADSASRKQEVQAWDGEVRQVSKHA
FSLKQLDNPARIPPCGWKCSKCDMRENLWLNLTDGSILCGRRYFDGSGGNNHAVEHYRET
GYPLAVKLGTITPDGADVYSYDEDDMVLDPSLAEHLSHFGIDMLKMQKTDKTMTELEIDM
NQRIGEWELIQESGVPLKPLFGPGYTGIQNLGNSCYLNSVVQVLFSIPDFQRKYVDKLEK
IFQNAPTDPTQDFSTQVAKLGHGLLSGEYSKPVPESGDGERVPEQKEVQDGIAPRMFKAL
IGKGHPEFSTNRQQDAQEFFLHLINMVERNCRSSENPNEVFRFLVEEKIKCLATEKVKYT
QRVDYIMQLPVPMDAALNKEELLEYEEKKRQAEEEKMPLPELVRAQVPFSSCLEAYGAPE
QVDDFWSTALQAKSVAVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDIS
QLRGTGLQPGEEELPDIAPPLVTPDEPKAPMLDESVIIQLVEMGFPMDACRKAVYYTGNS
GAEAAMNWVMSHMDDPDFANPLILPGSSGPGSTSAAADPPPEDCVTTIVSMGFSRDQALK
ALRATNNSLERAVDWIFSHIDDLDAEAAMDISEGRSAADSISESVPVGPKVRDGPGKYQL
FAFISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCASEKPPKDLGYIYFYQRVAS
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atggcggagctgagtgaggaggcgctgctgtcagtattaccgacgatccgggtccctaag
gctggagaccgggtccacaaagacgagtgcgccttctccttcgacacgccggagtctgag
gggggcctctacatctgtatgaacacgtttctgggcttcgggaaacagtatgtggagaga
catttcaataagactggccagcgagtctacctgcacctccggcggacccggcgtctgaaa
gaggaggaccctgctacaggcactggagacccaccccggaagaagcccacgcggctggct
attggtgttgaaggcgggtttgaccttagcgaggagaagtttgaattagacgaggatgtg
aagattgtcattttgccagattacctggagattgcccgggatggactggggggactgcct
gacattgtcagagatcgggtgaccagtgcagtggaggccctactgtcagctgactcagcc
tcccgcaagcaggaggtgcaggcatgggatggggaagtacggcaggtgtctaagcatgcc
ttcagcctcaagcagttggacaaccctgctcgaatccctccctgtggctggaagtgctct
aagtgtgacatgagagagaacctgtggctcaacctgacggatggctccatcctctgtggg
cgacgctacttcgacggcagtgggggcaacaaccacgctgtggagcactaccgggagacg
ggctacccattagctgtcaagctgggcaccatcacccctgatggagctgacgtgtactca
tatgatgaggatgacatggtcctggaccccagcctggctgagcacctgtcccacttcggc
atcgacatgctgaagatgcagaagacagacaagacgatgactgagttggagatagacatg
aaccagcggattggtgaatgggagctgatccaggagtcgggtgtgccactcaagcccctg
tttgggcctggctacacaggcatccagaacctgggtaacagctgctacctcaactccgtg
gtccaggtgctcttcagcatccctgacttccagaggaagtatgtggataagctggagaag
atcttccagaatgccccgacagaccctacccaggacttcagcacccaggtggccaagctg
ggccatggccttctctccggggagtattccaagccagtaccagagtcgggcgatggggag
cgggtgccagaacagaaggaagttcaagatggcattgcccctcggatgttcaaggccctc
atcggcaagggccaccctgaattctccaccaaccggcagcaagatgcccaggagttcttc
cttcaccttatcaacatggtggagaggaattgccggagctctgaaaatccgaatgaagtg
ttccgcttcttggtggaggagaagattaagtgcctggccacagagaaggtgaagtacacc
cagcgagttgactacatcatgcagctgcctgtgcccatggatgcagcccttaacaaagag
gagcttctggagtacgaggagaagaagcggcaagccgaagaggagaagatgccactgcca
gaactggttcgggcccaggtgcccttcagctcttgcctggaggcctacggggcccctgag
caggtggatgacttctggagcacggccctgcaggccaagtcagtagctgtcaagaccaca
cgatttgcctcattccctgactacctggtcatccagatcaagaagttcaccttcggctta
gactgggtgcccaagaaactggatgtgtccatcgagatgccagaggagcttgacatctcc
cagttgaggggcacagggctgcagcctggagaggaggagctgccagacattgccccaccc
ctggtcactccggatgagcccaaagcacccatgctggatgaatccgtcatcatccagttg
gtggagatgggcttccctatggacgcctgccgcaaagctgtctactacacgggcaacagc
ggggccgaggccgccatgaactgggtcatgtcacacatggatgatccagattttgcgaac
cccctcatcctgcctgggtctagcgggccaggctccacaagtgcagcagccgacccccct
cccgaggactgtgtgaccaccattgtctccatgggcttctcccgggaccaggccctgaaa
gcgctgcgggccacgaacaatagtttagaacgggctgtggactggatcttcagtcacatt
gatgacctggatgctgaagctgccatggacatctcagagggccgctcagctgccgactcc
atctctgagtctgtgccagtgggacctaaagtccgggatggtcctggaaagtatcagctc
tttgccttcattagtcacatgggcacctcgaccatgtgtggtcactacgtctgccacatc
aagaaggaaggcagatgggtgatctacaatgaccagaaagtgtgtgcctctgagaagccg
cccaaggacctgggctacatctacttctaccagagagtggccagctaa

DBGET integrated database retrieval system