KEGG   Macaca mulatta (rhesus monkey): 714090Help
Entry
714090            CDS       T01028                                 

Gene name
TPI1
Definition
triosephosphate isomerase 1
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:mcc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mcc01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mcc00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mcc00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mcc00562]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 213 aa AA seqDB search
MAPSRKFFVGGNWKMNRQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGH
SERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVK
DWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSEAVAQSTRIIYGGSVTGA
TCKELASQPDVDGFLVGGASLKPEFVDIINAKQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcgccttccaggaagttcttcgttggggggaactggaagatgaaccggcagaagcta
gatcccaagattgctgtggctgcacagaactgctacaaagtgactaatggggcctttact
ggggagatcagccctggcatgatcaaagactgcggagccacgtgggtggtcctggggcac
tcagagagaagacatgtctttggggagtcagatgagctgattgggcagaaagtggcccat
gctctggctgagggactcggagtaatcgcctgtattggggagaagctagatgaaagggaa
gctggcatcactgagaaggttgttttcgagcagacaaaggtcatcgcagataatgtgaaa
gactggagcaaggttgtcctggcctatgagcctgtgtgggccattggtactggcaagact
gcaacgccccaacaggcccaggaagtacatgagaagctccgaggatggcttaagtccaac
gtctctgaagcagtggctcagagcacccgtatcatttatggaggctctgtgactggggca
acctgcaaggagctggccagccagcctgacgtggatggcttccttgtgggtggtgcttcc
ctcaagcccgaattcgtggacatcatcaatgccaaacaatga

DBGET integrated database retrieval system