KEGG   Macaca mulatta (rhesus monkey): 714115Help
Entry
714115            CDS       T01028                                 

Gene name
CDC25C
Definition
cell division cycle 25 homolog C (S. pombe)
Orthology
K05867  
M-phase inducer phosphatase 3 [EC:3.1.3.48]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
MicroRNAs in cancer
Class
Cellular Processes; Cell growth and death; Cell cycle [PATH:mcc04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:mcc04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:mcc04914]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:mcc05206]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 399 aa AA seqDB search
MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPSTPVGKFLGDSTNL
SILSGSPGFFRTSGSAFSWDDNGKLVDSEMKYLGSPITAPKLDTNPNLGEDQAEEISNEL
MEFSLEDQEAKVNRSCLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRK
GLHLKKTVSLCDINITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALL
SGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFSFFLKKPIVPLDTQKRIIIV
FHCEFSSERGPRMCRSLREEDRSLNQYPALYYPELYILKGGYRDFFPEYLELCEPQSYCP
MHHQDHKAELLRCRSQSKVQEGERQLREQIALLVKDVSP
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtctacggaactcttctcatccacaagagaggaaggaagctctggctcaggaccaagt
tttaggtctaatcaaaggaaaatgttaaacctgctcctggagagagacacttcctttact
gtctgtccagatgtccctagcactccagtgggcaaatttcttggtgattctacaaaccta
agcattttgtctgggtcacctggattcttcaggacttcaggaagtgcatttagctgggat
gacaacggaaaattggtggacagtgaaatgaaatatctgggcagtcctattactgctcca
aagttggatacaaatccaaacctaggagaagaccaggcagaagagatttcaaatgaatta
atggagttttccctggaagatcaagaagcaaaggtgaacagaagctgcctatatcgctcc
ccctcgatgccagagaacttgaataggccaagactgaagcaggtggaaaaattcaaggac
aacacgataccagacaaagttaaaaaaaagtatttttctggccaaggaaaactcaggaag
ggcttacatttaaagaagacagtctctctatgtgacattaatatcactcagatgctggag
gaagattctaaccaggggcacctgattggtgatttttccaaggtatgtgcactgccaacc
gtgtcaggaaaacaccaagatctgaagtatgtcaacccagaaacggtggctgccttactg
tcggggaagttccagggtctgattgagaagttttatgtcattgattgtcgctatccatat
gagtacctgggaggacacatccagggagccttaaacttgtatagtcaggaagaactgttt
agcttctttctaaagaagcccattgtccctttggacacccagaagagaataatcatcgtg
ttccactgtgaattctcctcagagaggggcccccgaatgtgccgctctctgcgtgaagag
gacaggtctctgaaccagtatcctgcattgtactacccagagctatatatccttaaaggc
ggctacagagacttctttccagaatatttggagctgtgtgaaccacagagctactgccct
atgcatcatcaggaccacaaggctgagttgctgaggtgtcgaagccagagcaaagtgcag
gaaggggagcggcagctgcgggagcagattgcccttctggtgaaggatgtgagcccgtga

DBGET integrated database retrieval system