KEGG   Macaca mulatta (rhesus monkey): 714115Help
Entry
714115            CDS       T01028                                 

Gene name
CDC25C
Definition
(RefSeq) cell division cycle 25C
  KO
K05867  
M-phase inducer phosphatase 3 [EC:3.1.3.48]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
MicroRNAs in cancer
Module
DNA damage-induced cell cycle checkpoints
Cell cycle - G2/M transition
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    714115 (CDC25C)
   04114 Oocyte meiosis
    714115 (CDC25C)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    714115 (CDC25C)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    714115 (CDC25C)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     714115 (CDC25C)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     714115 (CDC25C)
 Protein Tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    714115 (CDC25C)
DNA repair and recombination proteins [BR:mcc03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    714115 (CDC25C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 507 aa AA seqDB search
MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPSTPVGKFLGDSTNL
SILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHHQHLMK
CSPAQLLCSTPNGLDRGHRKRDAMCSLSANKENENGTLKPLECQAPRNLRFQKRPGEPYV
SPLSLLDNGKLVDSEMKYLGSPITAPKLDTNPNLGEDQAEEISNELMEFSLEDQEAKASV
NRSCLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLHLKKTVSLCD
INITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFY
VIDCRYPYEYLGGHIQGALNLYSQEELFSFFLKKPIVPLDTQKRIIIVFHCEFSSERGPR
MCRSLREEDRSLNQYPALYYPELYILKGGYRDFFPEYLELCEPQSYCPMHHQDHKAELLR
CRSQSKVQEGERQLREQIALLVKDVSP
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgtctacggaactcttctcatccacaagagaggaaggaagctctggctcaggaccaagt
tttaggtctaatcaaaggaaaatgttaaacctgctcctggagagagacacttcctttact
gtctgtccagatgtccctagcactccagtgggcaaatttcttggtgattctacaaaccta
agcattttgtctggaggaaccccaaaacgttgcctcgatctttcgaatcttagcagtggg
gagataactgccactcagcttaccacttctgcagaccttgatgaaactggtcacctggat
tcttcaggacttcaggaagtgcatttagctgggatgaatcatcaccagcacctaatgaaa
tgtagcccagcacagcttctctgtagcactccgaatggtttggaccgtggccatagaaag
agagatgcaatgtgtagcttatctgcaaataaagaaaatgaaaacggcactttgaagccc
ttggagtgtcaggcacccaggaacctgaggtttcaaaagagaccaggggaaccttatgtg
tctcctctttctctgctggacaacggaaaattggtggacagtgaaatgaaatatctgggc
agtcctattactgctccaaagttggatacaaatccaaacctaggagaagaccaggcagaa
gagatttcaaatgaattaatggagttttccctggaagatcaagaagcaaaggcatcagtg
aacagaagctgcctatatcgctccccctcgatgccagagaacttgaataggccaagactg
aagcaggtggaaaaattcaaggacaacacgataccagacaaagttaaaaaaaagtatttt
tctggccaaggaaaactcaggaagggcttacatttaaagaagacagtctctctatgtgac
attaatatcactcagatgctggaggaagattctaaccaggggcacctgattggtgatttt
tccaaggtatgtgcactgccaaccgtgtcaggaaaacaccaagatctgaagtatgtcaac
ccagaaacggtggctgccttactgtcggggaagttccagggtctgattgagaagttttat
gtcattgattgtcgctatccatatgagtacctgggaggacacatccagggagccttaaac
ttgtatagtcaggaagaactgtttagcttctttctaaagaagcccattgtccctttggac
acccagaagagaataatcatcgtgttccactgtgaattctcctcagagaggggcccccga
atgtgccgctctctgcgtgaagaggacaggtctctgaaccagtatcctgcattgtactac
ccagagctatatatccttaaaggcggctacagagacttctttccagaatatttggagctg
tgtgaaccacagagctactgccctatgcatcatcaggaccacaaggctgagttgctgagg
tgtcgaagccagagcaaagtgcaggaaggggagcggcagctgcgggagcagattgccctt
ctggtgaaggatgtgagcccgtga

DBGET integrated database retrieval system