KEGG   Macaca mulatta (rhesus monkey): 714218Help
Entry
714218            CDS       T01028                                 

Gene name
ACACA
Definition
(RefSeq) acetyl-CoA carboxylase alpha
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00061  Fatty acid biosynthesis
mcc00620  Pyruvate metabolism
mcc00640  Propanoate metabolism
mcc01100  Metabolic pathways
mcc01212  Fatty acid metabolism
mcc04152  AMPK signaling pathway
mcc04910  Insulin signaling pathway
mcc04922  Glucagon signaling pathway
Module
mcc_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    714218 (ACACA)
   00640 Propanoate metabolism
    714218 (ACACA)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    714218 (ACACA)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    714218 (ACACA)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    714218 (ACACA)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    714218 (ACACA)
   04922 Glucagon signaling pathway
    714218 (ACACA)
Enzymes [BR:mcc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     714218 (ACACA)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     714218 (ACACA)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     714218 (ACACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATPgrasp_Ter Dala_Dala_lig_C ATP-grasp ATP-grasp_3 MetallophosN
Motif
Other DBs
NCBI-GeneID: 714218
NCBI-ProteinID: NP_001253707
Ensembl: ENSMMUG00000009349
UniProt: F7H9H5
Position
16
AA seq 2383 aa AA seqDB search
MWWSTLMSILRASSFWRWISTQTIRIIRALRAHFGGIMDEPSPLAKPLELNQHSRFIIGS
VSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDLGISSLQDGLALHIRSSMSGLH
LVKQGRDRKKIDSQRDFTVASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWSYE
MFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELILDIAKRIPVQ
AVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGS
GLRMDWQENDFSKRILNVPQELYEKGYVKDVDDGLQAAEEVGYPVMIKASEGGGGKGIRK
VNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQRR
HQKIIEEAPATIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYSQDGSFYFLELNPRLQ
VEHPCTEMVADVNLPAAQLQIAMGIPLYRIKDIRMMYGVSPWGDSPIDFEDSAHVPCPRG
HVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSW
GENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQMNRIDTGWLDRLIAEKVQA
ERPDTMLGVVCGALHVADVSLRNSVSNFLHSLERGQVLPAHTLLNTVDVELIYEGVKYVL
KVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNKTC
VFEKENDPSVMRSPSAGKLIQYIVEDGGHVFAGQCYAEIEVMKMVMTLTAVESGCIHYVK
RPGAALDPGCVLARMQLDNPSKVQQAELHTGSLPRIQSTALRGEKLHRVFHYVLDNLVNV
MNGYCLPDPFFSSKVKDWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPNVEKSIKKEMA
QYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQRYRSGIRGHM
KAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSDMNTVLNYIFSHAQVTKKNLLVTM
LIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESI
FLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYEL
NSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMSFSSNLNHYGMTHVASVSDVLLD
NSFTPPCQRMGGMVSFRTFEDFVRIFDEVMSCFSDSPPQSPTFPEAGHTSLYDEDKVPRD
EPIHILNVAIKTDCDIEDDRLAAMFREFTQQNKATLVDHGIRRLTFLVAQKDFRKQVNYE
VDRRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHL
YLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFNN
TNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTG
KAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAYGDKQGPLHGMLINTPYVTKDLL
QSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMSTQAFLPSPPLPSDMLTYTELVLDDQG
QLVHMNRLPGGNEIGMVAWKMTFKSPEYPEGRDIIVIGNDITYRIGSFGPQEDWLFLRAS
ELARAEGIPRIYVSANSGARIGLAEEIRHMFHVAWVDPEDPYKGYRYLYLTPQDYKRVSA
LNSVHCEHVEDEGESRYKITDIIGKEEGIGPENLRGSGMIAGESSLAYNEIITISLVTCR
AIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHC
TVCDDFEGVFTVLHWLSYMPKSVHSSVPLLNSKDPIDRIIEFVPTKAPYDPRWMLAGRPH
PTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELSIPADPAN
LDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKF
GAYIVDGLRECSQPVLVYIPPQAELRGGSWVVIDSSINPRHMEMYADRESRGSVLEPEGT
VEIKFRRKDLVKTMRRVDPVYIHLAERLGTPELSTAERKELENKLKEREEFLIPIYHQVA
VQFADLHDTPGRMQEKGVISDILDWKTSRTFFYWRLRRLLLEDLVKKKIHNANPELTDGQ
IQAMLRRWFVEVEGTVKAYVWDNNKDLAEWLEKQLTEEDGVHSVIEENIKCISRDYVLKQ
IRSLVQANPEVAMDSIIHMTQHISPTQRAEVVRILSTMDSPST
NT seq 7152 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggtctactctgatgtcaatcttgagggctagttctttttggaggtggatatct
actcagacaataagaattataagagctctaagagctcattttggaggaataatggatgaa
ccatctcccttggccaaacctctggagctgaaccagcactctcgattcataattggttct
gtgtctgaagataactcagaggatgagatcagcaacctggtgaagctggacctactggag
gagaaggagggttctttgtcacctgcttctgttggctcagatacactctctgatttgggg
atctctagcctacaggatggcctggccttgcacataaggtccagcatgtctggcttgcac
ctagtaaagcagggccgagacagaaagaaaatagattctcaacgagatttcactgtggct
tctccagcagaatttgttactcgctttgggggaaataaagtgattgagaaggttcttatt
gctaacaatggcattgcagcagtgaaatgcatgcggtctatccgtaggtggtcttatgaa
atgtttcgaaatgaacgtgcaattcgattcgttgtcatggtcacacctgaagaccttaaa
gccaatgcagaatacattaagatggcagatcactacgtgccggtgcctggaggaccaaac
aacaacaactatgcaaatgtggaattaattcttgatattgctaaaaggatcccagtacaa
gcagtgtgggctggctggggtcatgcttctgagaatcccaaactaccggaacttctcttg
aaaaatggcattgccttcatgggtcctccaagccaggccatgtgggctttaggggataag
attgcatcttccatagtggctcaaactgcaggtatcccaactcttccctggagtggcagt
ggtcttcgtatggactggcaggaaaatgatttttcaaaacgtatcttaaatgttccccag
gagctatatgaaaaaggttatgtgaaagatgtggatgacgggctacaggcagctgaggaa
gttggatatccagtaatgatcaaggcctcagaaggaggaggagggaagggaattagaaaa
gtcaacaatgcagatgacttccctaacctcttcagacaggttcaagctgaagtccctgga
tctcccatatttgtgatgagactagccaaacaatctcgtcatctggaggtgcagatctta
gcggaccaatatggcaatgccatctctttgtttggtcgtgattgctctgtacaacgcagg
catcagaagattattgaagaggcaccagctactattgctactccagcagtatttgaacac
atggaacagtgtgcggtgaaacttgccaaaatggtgggttatgtgagtgctgggactgtg
gaatacctgtacagccaggacggcagcttctactttctggaattgaatcctcggctacag
gtagagcacccttgtacagagatggtggctgatgtcaatctccctgcagctcagctccag
attgccatggggattcctctatatagaatcaaggatatccgtatgatgtacggggtatct
ccctggggtgattctcccattgattttgaagattctgcacatgttccttgcccaaggggc
catgttattgctgctcggatcactagtgaaaatccagatgagggttttaagcccagttca
ggaacagttcaggaactaaatttccgcagcaataagaatgtttggggatacttcagtgtt
gctgctgcagggggacttcatgaatttgctgattctcagtttggtcactgcttttcttgg
ggagaaaacagagaggaggcaatttcaaacatggtggtggctttgaaggagctgtctatt
cggggtgactttcgaactacagttgaatacctgatcaaattgttagagactgaaagcttt
cagatgaacagaattgatactggctggctggacagactgatagcagaaaaagtacaggct
gagcgacctgacaccatgttgggggttgtatgtggggccctccacgtggcagacgtgagc
ctgcggaatagcgtctctaacttccttcactccttagaaaggggtcaagtccttcctgct
catacactgttgaatacagtagatgttgaacttatctatgagggagtcaagtatgtactt
aaggtgactcgacagtcccccaactcctatgtggtgatcatgaatggctcatgtgtagaa
gtagatgtacatcggctgagtgacggtggactgctcttgtcctatgatggcagcagttat
actacgtacatgaaggaggaagtggatagatatcgcatcacaattggcaataaaacctgt
gtgtttgagaaggaaaatgacccatcagtgatgcgctcaccttctgctgggaagttaatc
cagtacattgtagaagatggaggtcatgtgtttgctggccagtgctatgctgagattgag
gtgatgaagatggtaatgaccttaacagctgtggagtctggctgtatccattacgtcaag
cgacctggagcagctcttgaccctggctgtgtactagccagaatgcaactggacaacccc
agcaaggttcagcaggctgagcttcacacaggtagtctgccacggatccagagcacggca
ctcagaggcgagaaactgcatcgagtgttccattatgtcctggataatctggtcaacgta
atgaatggatactgccttccagatcctttctttagcagcaaggtaaaagactgggtagag
cgattgatgaaaaccctcagagatccctccctgcctctcctagaattgcaagatatcatg
actagcgtgtctggccgcattccccccaatgtggagaagtctatcaagaaggaaatggct
cagtatgctagcaacatcacatcagtcctctgtcagtttcccagtcagcagattgccaac
atcctagatagccatgcagctacattgaaccggaaatctgaacgggaggtcttctttatg
aatactcagagcattgttcagctggtacagaggtaccgaagtggcatccgaggccacatg
aaggctgtggtgatggatctgctccggcagtacctgcgagtagagacacaattccagaat
ggtcactatgacaaatgtgtattcgccctccgggaagagaataaaagtgacatgaacact
gtactgaactacatcttctctcacgctcaagtcaccaagaagaatcttctggtcacaatg
cttatcgatcagttgtgtggccgggaccctactctcactgatgagctgctgaatattctc
acagagctaactcaactcagtaagactaccaatgctaaagtagcacttcgagcacgccag
gttcttattgcctcccatttgccatcatacgagcttcgccataaccaagtagagtctatc
ttcctatcagctattgacatgtatggacatcaattttgcattgagaacctgcagaaactc
atcctatcagaaacatctatttttgatgtcctaccaaacttcttctatcacagcaaccaa
gtagtgaggatggcagctctggaggtgtatgttcgaagggcttatattgcctacgaactt
aacagcgtacaacaccgccagcttaaggacaacacctgtgtggtggaattccagttcatg
ctgcccacatctcatccaaacagagggaacatccctacgctaaacagaatgtccttctcc
tccaacctcaaccactatggcatgacccatgtagctagtgtcagcgatgtgctgttggac
aactcattcactccaccttgtcagcggatgggcggaatggtctcttttcggactttcgaa
gattttgtcaggatctttgatgaagtgatgagctgcttctctgactccccaccccagagt
cccacattccctgaggcaggtcacacgtctctttatgatgaagataaggttcctagggat
gaaccaattcacattctcaatgtggctatcaagaccgactgtgatattgaggatgacagg
ctggcagctatgttcagagaatttacccagcaaaataaagctaccctggttgaccatggg
atccggcgccttactttcctggttgcacaaaaggatttcagaaaacaggtcaactatgag
gtggatcggagatttcatagagaattccctaaattttttacattccgagcaagggataag
tttgaggaggatcgtatctatcgtcatctggagcctgctctggctttccagttagagctg
aaccggatgagaaattttgacctcactgccattccatgtgctaatcacaagatgcacctg
tatctcggggcagccaaggtggaagtgggcacagaagtgacagactacaggttctttgtt
cgtgcaatcatcaggcattctgatctggtcaccaaggaagcttcttttgaatatctgcaa
aatgaaggggagcggctactcctggaagccatggatgagttggaagttgcttttaacaat
acaaatgtccgcactgactgtaaccacatcttcctcaactttgtgcccacggttatcatg
gacccatcaaagattgaggaatctgtgcggagcatggtaatgcggtatggaagtcgcctg
tggaaattgcgcgtcctccaggcagaactgaaaatcaacattcgcctgacgccaactgga
aaagcaattcccatccgcctcttcctgacaaacgagtctggctattacttggatatcagc
ctatacaaggaagtgactgactccaggacagcacagatcatgtttcaggcatatggagac
aaacagggaccacttcatggaatgttaatcaatactccttatgtgaccaaagacctgctg
caatcaaagaggttccaggcacaatccttagggacaacatacatatatgatatcccagag
atgtttcggcagtccctgatcaaactctgggagtctatgtccactcaagcatttcttcca
tctccccctctgccttctgacatgctgacttacaccgaactggtattggatgatcaaggt
cagctggtccacatgaacaggcttccaggaggaaatgagattggcatggtagcttggaaa
atgacctttaaaagtcctgaatatccagaaggccgagatatcattgttattggcaatgac
atcacataccgaattgggtcctttgggcctcaagaggattggttatttctcagagcttct
gaacttgccagggcagaaggtattccacgcatctatgtatcagccaacagtggagcaaga
atcggactggcagaagaaattcgtcatatgtttcatgtggcctgggtagatcctgaggat
ccttacaagggatacaggtatttatatctgacccctcaagattataagagagtcagtgct
ctcaactctgtccattgtgaacacgtggaggatgaaggagaatccaggtacaagataaca
gatattattgggaaagaagagggaattggacctgagaaccttcgaggttctggaatgatt
gctggagaatcctcattggcctataatgagatcattaccatcagcctggtgacgtgccgg
gccattgggattggggcttaccttgtccggctgggacagagaaccatccaggttgagaat
tctcacttaattctaacaggagctggagccctcaacaaagtcctcgggcgggaagtgtac
acctccaataaccagcttgggggcatccagatcatgcacaacaatggggtgacccactgc
actgtgtgtgatgactttgaaggggttttcactgtcctgcactggctgtcttacatgccc
aagagcgtgcacagttcagttcctcttctgaactcaaaggatcctatagacagaatcatc
gagtttgttcccacaaaggccccatatgatcctcgatggatgctagcaggccgtcctcat
ccaacccaaaaaggtcaatggttgagtggcttttttgactatggatctttctcagagatt
atgcagccctgggcacagactgtggtggttggtagagccaggctaggaggaatacctgtg
ggagttgttgctgtagaaacccgaacagtagagctaagtatcccagctgatccagcaaac
ttggattctgaagccaagataatccagcaggctggccaggtttggttcccagattctgcg
tttaagacgtatcaggccatcaaggacttcaaccgggaagggctgcctctgatggtcttt
gccaactggagaggcttctctggtggaatgaaagatatgtacgaccaagtgctgaagttt
ggtgcttacattgtggacggcttgagggagtgctcccagcctgtgctggtttacattcct
ccccaggctgagctgcggggcggctcctgggtagtgattgactcctccatcaatccccgg
cacatggagatgtatgctgaccgagaaagcaggggatctgttctggagccagaagggaca
gtagaaatcaaattccgcagaaaggatctggtgaaaaccatgcgtcgggtggacccagtc
tacatccacttggctgagcgattggggaccccggagctaagcacagctgaacggaaggag
ttggagaacaagttgaaggagcgggaggaattcctaattcccatttaccatcaggtagcc
gtgcagtttgctgacttgcacgacacaccaggccggatgcaggagaagggtgttattagc
gatatcctggattggaagacatcccgtaccttcttctactggcggctgaggcgtctcctg
ctggaggacctggtcaagaagaaaatccacaatgccaaccctgagctgactgacggccag
attcaagccatgttaaggcgctggtttgtggaagtggaaggtacagtgaaggcctatgtt
tgggacaataataaggatctggcggagtggctagaaaaacagctgacagaggaggatggc
gttcactcggtaatagaggaaaacatcaaatgcatcagcagagactacgtcctcaagcaa
atccgcagcttggtccaggccaatccagaggtcgccatggattccatcatccatatgacc
cagcacatatcacctactcagcgagcagaagttgtacggatcctctccacaatggactcc
ccttccacgtag

DBGET integrated database retrieval system