KEGG   Macaca mulatta (rhesus monkey): 714545Help
Entry
714545            CDS       T01028                                 

Gene name
SIRT6
Definition
sirtuin 6
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     714545 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
19
AA seq 328 aa AA seqDB search
MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSHVVFHTGAGISTASG
IPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRNA
DLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMK
HLGLEIPAWDGPHVLERALPPLPRPPTPKLEPKEESPTRINGSIPAGPKQEPCAQHNGSE
PASPKRERPTSPAPNRPPKRVKAEAVPS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaattatgcggcggggctgtcgccgtacgcggacaagggcaagtgcggcctc
cctgagatcttcgaccccccggaggagctggagcggaaggtgtgggagctggcaaggctg
gtctggcagtcttcccatgtggtgttccatacgggtgccggcatcagcactgcctctggc
attcccgacttcaggggtccccacggagtctggaccatggaggagcgaggcctggccccc
aagttcgacaccacctttgagagcgcacggcccacgcagacccacatggcgctggtgcag
ctggaacgcgtgggcctccttcgcttcctggtcagccagaacgtggacgggctccatgtg
cgctcaggcttccctagggacaaattggcagagcttcatgggaacatgttcgtggaagaa
tgtgccaagtgtaagacgcagtatgtccgggacacagtcgtgggcaccatgggcctgaag
gccacgggccggctctgcaccgtggctaaggcaagggggctgcgggcctgcaggaacgcc
gacctgtccatcacgctgggaacatcactgcagatccgacccagtgggaacctgccgctg
gctaccaagcgccgggggggccgcctggtcatcgtcaacctgcagcccaccaagcacgac
cgccatgctgacctccgcatccacggctacgtcgacgaggtcatgacccggctcatgaag
cacctggggctggagatccccgcctgggacggcccccacgtgctggagagggcgctgcca
cccctgccccgcccgcctacccccaagctggagcccaaggaggaatcacccacccggatc
aacggctctatccctgccggccccaagcaggagccctgcgcccagcacaacggctcagag
cccgccagccccaaacgggagcggcccaccagccctgcccccaacagaccccccaaaagg
gtgaaggccgaggcggtccccagctga

DBGET integrated database retrieval system