KEGG   Macaca mulatta (rhesus monkey): 714605Help
Entry
714605            CDS       T01028                                 

Gene name
MLYCD
Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    714605 (MLYCD)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    714605 (MLYCD)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    714605 (MLYCD)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    714605 (MLYCD)
Enzymes [BR:mcc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     714605 (MLYCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
20
AA seq 493 aa AA seqDB search
MRGLGPGLTARRLLPLRFTPRPPGPRLASGQATGALERAMDELLRRAVPPTPAYELREKT
PAPAEGQCADFVSFYGGLAETAERAELLGRLARGFGVDHGQVAEQSAGVLQLRQQQREAA
VLLQAEDRLRYALVPRYRGLFHHISKLDGGVRFLVQLRADLLEAQALKLVEGPDVREMNG
VLKGMLSEWFSSGFLNLERVTWHSPCEVLQKISEAEAVHPVKNWMDMKRRVGPYRRCYFF
SHCSTPGEPLVVLHVALTGDISSNIQAIVKECPPSETEEKNRIAAAIFYSISLTQQGLQG
VELGTFLIKRVVKELQREFPHLGVFSSLSPIPGFTKWLLGLLNSQVKDHGRNELFTDSEC
KEISEITGGPTNETLKLLLGSSEWVQSETLVRALQTPLMRLCAWYLYGEKHRGYALNPVA
NFHLQNGAVLWRINWMADVSLKGITGSCGLMANYRYFLEETGPNSTSYLSSKNIKASEQV
LSLVAQFQKNSKL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgagaggcctcgggccaggcttgacggccaggcgtctcctcccgctgcggtttaccccg
cggccgcccgggccccggctggctagcgggcaggcgactggcgccctggagcgggccatg
gacgagctgctgcgccgcgcggtgccgccgacaccggcctacgagctgcgcgagaaaaca
ccggcgcccgccgagggtcagtgcgcggacttcgtgagcttctacggcgggctggccgag
acagccgagcgggccgagctgctgggccgcctggcgcggggcttcggtgtggaccacggc
caggtggcggagcagagcgccggcgtgctccagctgcgccagcagcagcgggaggcggcg
gtgctgctgcaggccgaggaccggctgcgctacgcgctggtgccgcgctaccgcggcctc
ttccaccacatcagcaagctggacggcggcgtgcgcttcctggtgcagctgcgggccgac
ctgctcgaggctcaggccctcaagctggtggaggggccggacgtccgggaaatgaatggc
gtgctgaaaggaatgctctcagaatggttttcctccgggttcctgaacctagaacgggtc
acctggcattcaccgtgtgaagtgcttcagaaaattagtgaggctgaggctgtgcatcct
gtaaaaaactggatggacatgaagcgccgcgttgggccctacagaagatgttacttcttt
tctcactgttcaactcctggggagcccctggtcgttttgcatgtggcactgactggtgac
atctccagcaacatccaggcaatcgtgaaggaatgtcctccatcagaaacggaagagaag
aacagaattgctgctgcgatcttttattccatcagtttgacccagcagggactccaaggg
gtggagctgggaacattcctcataaagcgagtcgtcaaggagttgcagcgagagtttcct
caccttggagtgttttcgagtctgtcacctatacctggattcaccaaatggcttctgggg
cttctgaactcgcaagtgaaggatcacgggaggaatgaactcttcacagattcggagtgt
aaggaaatctcggagatcacaggtggccccactaacgagaccctcaagctcctcctcggc
agcagcgagtgggtgcagtcggagaccctggtgcgggcgctgcagactccgctcatgagg
ctgtgcgcctggtacctgtatggagagaagcaccgcggctacgcgctgaaccccgtggcc
aacttccacctgcagaacggggcggtgctgtggcgcatcaactggatggcggatgtgagc
ctcaaaggcatcaccggctcctgcggcctcatggccaactaccgctacttcctggaggag
acgggccccaacagcacctcctacctcagctccaagaacatcaaagcctctgagcaggtg
ctcagcctagtggcccagtttcagaagaacagcaagctctga

DBGET integrated database retrieval system