KEGG   Macaca mulatta (rhesus monkey): 714702Help
Entry
714702            CDS       T01028                                 

Gene name
P4HB
Definition
(RefSeq) prolyl 4-hydroxylase, beta polypeptide
  KO
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    714702 (P4HB)
Enzymes [BR:mcc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     714702 (P4HB)
Chaperones and folding catalysts [BR:mcc03110]
 Protein folding catalysts
  Protein disulfide isomerase
   714702 (P4HB)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   714702 (P4HB)
  Exosomal proteins of colorectal cancer cells
   714702 (P4HB)
  Exosomal proteins of bladder cancer cells
   714702 (P4HB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
16
AA seq 510 aa AA seqDB search
MLRRALLCLAVAAAARVYADAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKA
LAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTA
GREADDIVNWLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEA
IDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKYNQLPLVI
EFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSSFRTAAESFKGKILFIFIDSDHTDN
QRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAERITEFCHRFLEGKIKPHLMSQ
ELPEDWDKQPVKVLVGKNFEEVAFDENKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHE
NIVIAKMDSTANEVEAIKVHSFPTLKFFPASVDRTVIDYNGERTLDGFKKFLESGGQDGA
GDDDDLEDLEEAEEPDMEEDDDQKAVKDEL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgccgcgctctgctgtgcctggccgtggccgcggccgcccgggtgtacgccgac
gcccccgaggaggaggaccacgtcctggtgctgcggaaaagcaactttgcggaggcgctg
gcggcccacaagtacctgctggtggagttctatgccccttggtgtggccactgcaaggct
ctggcccctgagtatgccaaagccgctgggaagctgaaggcagaaggttccgagatcagg
ttggccaaggtggacgccacggaggagtctgacctggcccagcagtatggcgtgcgcggc
tatcccaccatcaagttcttcaggaacggagacacggcttcccccaaggaatatacagct
ggcagagaggctgatgacatcgtgaactggctgaagaagcgcacgggcccggctgccacc
accctgcctgacggcgcagctgcagagtccttggtggagtccagcgaggtggctgtcatc
ggcttcttcaaggacgtggagtcagactctgccaagcagttcttgcaggcggcagaggcc
atcgatgacataccatttgggatcacttccaacagtgacgtgttctccaaataccagctc
gacaaagatggggttgtcctctttaagaagtttgatgaaggccggaacaactttgaaggg
gaggtcaccaaggagaacctgctggactttatcaaatacaaccagctgccccttgtcatc
gagttcaccgagcagacagccccgaagatttttggaggtgaaatcaagactcacatcctg
ctgttcctgcccaagagtgtgtctgactatgacggcaaactgagcagcttcagaacggca
gccgagagctttaagggcaagatcctgttcatcttcatcgacagcgaccacacggacaac
cagcgcatcctggagttctttggcctgaagaaggaagagtgcccagccgtgcgtctcatc
accctggaggaggagatgaccaagtacaagcccgaatcggatgagctgacagcagagagg
atcacagagttctgtcaccgcttcctggagggcaaaatcaagccccacctgatgagccag
gagctgccggaggactgggacaagcagcctgtgaaggtgcttgttgggaagaactttgaa
gaggtggcttttgacgagaacaagaacgtcttcgtggagttctatgccccgtggtgtggt
cactgcaaacagttggctcccatttgggataaactgggagaaacgtacaaggaccatgag
aacatcgttatcgccaagatggactcgaccgccaacgaggtggaggccatcaaagtgcac
agcttccccacactcaagttctttcctgccagcgtcgacaggacggtcatcgattacaat
ggggaacgcacactggatggttttaagaagttcctggagagcggtggccaggatggggca
ggggatgatgacgatctcgaggacctggaagaagcagaggagccagacatggaggaagat
gatgatcagaaagctgtgaaagatgaactgtaa

DBGET integrated database retrieval system