KEGG   Macaca mulatta (rhesus monkey): 714702Help
Entry
714702            CDS       T01028                                 

Definition
protein disulfide-isomerase-like
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    714702
Enzymes [BR:mcc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     714702
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   714702
  Exosomal proteins of colorectal cancer cells
   714702
  Exosomal proteins of bladder cancer cells
   714702
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 531 aa AA seqDB search
MLRRALLCLAVAAAARVYADAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKA
LAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTA
GREADDIVNWLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEA
IDDIPFGITSNSDVFSKYQLDKDGVVLFKKVSGPRQLCPPHSSFSALDVWSGRLDSVDSL
VVMCPRRREGSFVALACQDSHVAIHVGSPQRALQPRKASAGAAGHWDHGAGGRGQPSPSP
VQPPFLPQILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAE
RITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEEVAFDENKNVFVEFYAPWC
GHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAIKVHSFPTLKFFPASVDRTVIDY
NGERTLDGFKKFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQKAVKDEL
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgccgcgctctgctgtgcctggccgtggccgcggccgcccgggtgtacgccgac
gcccccgaggaggaggaccacgtcctggtgctgcggaaaagcaactttgcggaggcgctg
gcggcccacaagtacctgctggtggagttctatgccccttggtgtggccactgcaaggct
ctggcccctgagtatgccaaagccgctgggaagctgaaggcagaaggttccgagatcagg
ttggccaaggtggacgccacggaggagtctgacctggcccagcagtatggcgtgcgcggc
tatcccaccatcaagttcttcaggaacggagacacggcttcccccaaggaatatacagct
ggcagagaggctgatgacatcgtgaactggctgaagaagcgcacgggcccggctgccacc
accctgcctgacggcgcagctgcagagtccttggtggagtccagcgaggtggctgtcatc
ggcttcttcaaggacgtggagtcagactctgccaagcagttcttgcaggcggcagaggcc
atcgatgacataccatttgggatcacttccaacagtgacgtgttctccaaataccagctc
gacaaagatggggttgtcctctttaagaaggtgagtgggcccaggcagctctgcccgccc
cacagctccttcagtgccctggatgtctggagtggccgtttggactctgtggacagtttg
gtggtcatgtgtccgcgaaggcgggagggcagtttcgttgctcttgcctgccaggactca
cacgtggccatccatgtgggctccccacagcgggcactgcagcccaggaaagcctctgcg
ggggccgctggtcactgggaccatggggctggaggcagaggccagccatctccctcacct
gtgcaacctccttttctcccccagatcctgttcatcttcatcgacagcgaccacacggac
aaccagcgcatcctggagttctttggcctgaagaaggaagagtgcccagccgtgcgtctc
atcaccctggaggaggagatgaccaagtacaagcccgaatcggatgagctgacagcagag
aggatcacagagttctgtcaccgcttcctggagggcaaaatcaagccccacctgatgagc
caggagctgccggaggactgggacaagcagcctgtgaaggtgcttgttgggaagaacttt
gaagaggtggcttttgacgagaacaagaacgtcttcgtggagttctatgccccgtggtgt
ggtcactgcaaacagttggctcccatttgggataaactgggagaaacgtacaaggaccat
gagaacatcgttatcgccaagatggactcgaccgccaacgaggtggaggccatcaaagtg
cacagcttccccacactcaagttctttcctgccagcgtcgacaggacggtcatcgattac
aatggggaacgcacactggatggttttaagaagttcctggagagcggtggccaggatggg
gcaggggatgatgacgatctcgaggacctggaagaagcagaggagccagacatggaggaa
gatgatgatcagaaagctgtgaaagatgaactgtaa

DBGET integrated database retrieval system