KEGG   Macaca mulatta (rhesus monkey): 714818Help
Entry
714818            CDS       T01028                                 

Gene name
HIST2H2BE
Definition
(RefSeq) histone H2B type 2-E
  KO
K11252  histone H2B
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc05034  Alcoholism
mcc05203  Viral carcinogenesis
mcc05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    714818 (HIST2H2BE)
  Immune diseases
   05322 Systemic lupus erythematosus
    714818 (HIST2H2BE)
  Substance dependence
   05034 Alcoholism
    714818 (HIST2H2BE)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    714818 (HIST2H2BE)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   714818 (HIST2H2BE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 714818
NCBI-ProteinID: XP_001104774
Ensembl: ENSMMUG00000043700
UniProt: F7BDS2
Position
1
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccggcaaaatccgctccggctcctaaaaagggctccaagaaagccgtcacc
aaagcccagaagaaagacggcaagaagcgcaagcgcagccgcaaggagagctactccatc
tacgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacattttcgagcgcatcgcgggagaggcgtcccgc
ctggcgcactacaacaagcgctccaccatcacgtcccgcgagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggcagtcacc
aagtacaccagctccaagtga

DBGET integrated database retrieval system