KEGG   Macaca mulatta (rhesus monkey): 714849Help
Entry
714849            CDS       T01028                                 

Gene name
GTF3C4
Definition
general transcription factor IIIC, polypeptide 4, 90kDa (EC:2.3.1.48)
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     714849 (GTF3C4)
Transcription machinery [BR:mcc03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     714849 (GTF3C4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 823 aa AA seqDB search
MNTADQARVGPADDGPAPPGEEEGEEGGGEAGGKEPAADAAPGPSAAFRLMVTRREPAVK
LQYAVSGLEPLAWSEDHRVSVSTARSIAVLELICDVHNPGQDLVIHRTSVPAPLNSCLLK
VGSKTEVAECKEKFAASKDPTVSQTFMLDRVFNPEGKALPPMRGFKYTSWSPMGCDANGR
CLLAALTMDNRLTIQANLNRLQWVQLVDLTEIYGERLYETSYRLSKNEAPEGNLGDFAEF
QRRHSMQTPVRMEWSGICTTQQVKHNNECRDVGSVLLAVLFENGNIAVWQFQLPFVGKES
ISSCNTIESGITSPSVLFWWEYEHNNRKMSGLIVGSAFGPIKILPVNLKAVKGYFTLRQP
VILWKEMDQLPVHSIKCVPLYHPYQKCSCSLVVAARGSYVFWCLLLISKAGLNVHNSHVT
GLHSLPIVSMTADKQNGTVYTCSSDGKVRQLIPIFTDVALKFEHQLIKLSDVFGSVRTHG
IAVSPCGAYLAIITTEGMVNGLHPVNKNYQVQFVTLKTFEEAAAQLLESSVQNLFKQVDL
IDLVRWKILKDKHIPQFLQEALEKKIESSGVTYFWRFKLFLLRILYQSMQKTPSEALWKP
THEDSKILLVDSPGMGNADDEQQEEGTSSKQVVKQGLQERSKEGDVEEPTDDSLPPTGDA
GGREPMEEKLLEIQGKIEAVEMHLTREHMKRVLGEVYLHTWITENTSIPTRGLCNFLMSD
EEYDDRTARVLIGHISKKMNKQTFPEHCSLCKEILPFTDRKQAVCSNGHIWLRCFLTYQS
CQSLIYRRCLLHDSIARHPAPEDPDWIKRLLQSPCPFCDSPVF
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgaacacggccgaccaggcccgagtggggcccgcggacgacgggcctgcgccacccgga
gaggaggagggagaggaggggggcggcgaggcgggcgggaaggagccagcagcggacgcg
gccccggggcccagcgctgcattccgcctcatggtgactcggcgggagccggccgtgaag
ctgcagtatgcggtgagcggcctggaaccgctggcttggtccgaggaccaccgcgtgtct
gtgtccacggcccgcagcatcgctgtgctggagctcatctgcgacgtgcacaacccgggc
caggacctggttatccaccgcacctcggtgcccgcccctctcaacagctgtctcctcaaa
gttggctcaaaaacagaagttgctgagtgcaaggagaaattcgccgcctccaaggacccc
acggtcagtcagactttcatgttggatagagtgttcaaccctgaggggaaggctttacca
ccaatgagaggattcaagtacaccagctggtctcccatgggttgtgatgctaatggcagg
tgcctcttggcagcactgaccatggacaatcgcctgaccatccaggcaaatctcaacaga
ctgcagtgggtccagctggttgacctgactgagatctatggagaacgtctttatgagacc
agttacaggctctctaaaaatgaggccccggaaggaaatctcggggattttgctgagttt
cagaggagacacagcatgcagaccccagtcagaatggagtggtcgggcatctgtaccact
cagcaggtcaagcataacaatgaatgccgggatgttggtagtgtgctcctggccgtcctc
tttgaaaatggtaatatcgccgtgtggcagtttcagctgccctttgtaggaaaagaatcc
atctcttcatgcaacacgattgagtcaggaatcacctctcccagtgtattgttttggtgg
gaatatgagcacaataatcgaaaaatgagtggccttattgtggggagtgcttttggaccc
ataaaaattcttcctgtcaatctcaaagcagtcaaaggctatttcactttaaggcagcct
gttatcttgtggaaagaaatggaccagttacctgtgcacagcatcaaatgtgtaccactt
tatcatccttaccagaagtgtagttgcagcttagtagtggctgcaagaggctcttatgta
ttttggtgtcttcttctgatctccaaagcagggctgaatgttcacaattcccatgtcaca
ggccttcactcactgccgattgtctccatgactgcagacaaacagaatggaacagtctat
acttgctccagtgatggaaaggtgaggcagctgattcccattttcacagatgttgcattg
aagtttgaacaccagttgattaaactctcagatgtgtttggctcagtgaggactcacggg
atagcagtgagcccctgcggtgcgtacctggccatcattaccactgagggtatggtcaac
ggcctccaccccgttaacaaaaactaccaggtgcagtttgttactctcaaaacctttgaa
gaggcagctgctcagctcctggaatcttcagttcaaaacctttttaagcaggtagattta
atagacctagtacgctggaagattttaaaagataaacatatccctcaatttttacaagaa
gctttggaaaaaaagattgaaagcagtggagtcacctatttttggcgttttaagcttttc
ctcctgaggattttatatcagtcaatgcagaaaaccccttcagaagccttgtggaaaccc
acccatgaggactcaaaaatcttgctagtggattcacctgggatgggcaatgctgacgat
gaacagcaggaagaaggcacttcttccaaacaggtggtgaagcaaggcctgcaggagagg
agcaaggaaggagatgtagaggagcccactgatgactcgctccccccaactggagatgct
ggaggccgggagccaatggaagagaaactcctggaaatccaagggaagatcgaagctgtg
gagatgcacttgaccagggaacacatgaagcgagtcttaggagaagtgtatctgcacacc
tggatcacagaaaacactagcatccccacccgaggactctgtaactttttaatgtctgat
gaagagtatgatgacagaacagcacgggtgctgattggacatatctcaaagaagatgaac
aaacagactttccctgagcactgtagtttgtgtaaagagatcttgccattcacagatcgc
aaacaggcagtctgttccaatggccacatttggctccggtgcttcttaacctaccagtcc
tgccagagtttgatatatagaaggtgtttgctccatgacagcattgcccggcatccagct
ccagaagatcccgactggattaagaggttactgcaaagcccctgccctttctgtgattct
cctgtcttctaa

DBGET integrated database retrieval system