KEGG   Macaca mulatta (rhesus monkey): 715265Help
Entry
715265            CDS       T01028                                 

Definition
laminin subunit gamma-1-like
Orthology
K05635  
laminin, gamma 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Prion diseases
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    715265
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    715265
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    715265
 Human Diseases
  Cancers
   05200 Pathways in cancer
    715265
   05222 Small cell lung cancer
    715265
  Neurodegenerative diseases
   05020 Prion diseases
    715265
  Infectious diseases
   05146 Amoebiasis
    715265
   05145 Toxoplasmosis
    715265
Cell adhesion molecules and their ligands [BR:mcc04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     Laminin-1 Extracellular matrix (ECM) components
      715265
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
      715265
     Laminin-2 Extracellular matrix (ECM) components
      715265
   VLA-2
     Laminin-1 Extracellular matrix (ECM) components
      715265
   VLA-3
      715265
     Laminin-10 Extracellular matrix (ECM) components
      715265
     Laminin-11 Extracellular matrix (ECM) components
      715265
   VLA-6
     Laminin-1 Extracellular matrix (ECM) components
      715265
     Laminin-8 Extracellular matrix (ECM) components
      715265
   VLA-7
     Laminin-1 Extracellular matrix (ECM) components
      715265
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
     Laminin-1 Extracellular matrix (ECM) components
      715265
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 1608 aa AA seqDB search
MRGSQRAAPXLRRRGRLWPVLAVLAAAAAGCAQAAMDECTDEGGRPQRCMPEFVNAAFNV
TVVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQ
TMLAGVQYPSSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGS
CENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQ
EWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECMKNEFD
KLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRST
GHGGHCTNCQDNTDGAHCERCRENFFRLGNNEACSPCHCSPVGSLSTQCDSYGRCSCKPG
VMGDKCDRCQPGFHSLTEAGCRPCSCDPSGSIDECNVETGRCVCKDNVEGFNCERCKPGF
FNLESSNPRGCTPCFCFGHSSVCTNAVGYSVYSISSSFQIDEDGWRVEQRDGSEASLEWS
SERQDIAVISDSYFPRYFIAPAKFLGKQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGAG
LRVSVPLIAQGNSYPSETTVKYVFRLHEATDYPWRPALTPFEFQKLLNNLTSIKIRGTYS
ERSAGYLDDVTLASARPGPGVPATWVESCTCPVGYGGQFCEMCLSGYRRETPSLGPYSPC
VLCTCNGHSETCDPETGVCNCRDNTAGPHCEKCSDGYYGDSTAGTSSDCQPCPCPGGSSC
AVVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCNDNIDPNAVGN
CNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCKACSCNPYGTVKQQSNCNPV
TGQCECLPHVTGRDCGACDPGFYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGIT
GQHCERCEVNHFGFGPEGCKPCDCHPEGSLSLQCKDDGHCECREGFVGNRCDQCEENYFY
NRSWPGCQECPACYRLVKDKVADHRVKLQELESLIANLGTGDEMVTDQAFEDRLKEAERE
VMDLLREAQDVKDVDQNLMDRLQRVNNSLSSQISRLQNIRNTIEETGNLAEQARAHVENT
ERLIEIASRELEKAKVAAANVSVTQPESTGDPNNMTLLAEEARKLAERHKQEADDIVRVA
KTANDTSTEAYNLLLRTLAGENQTAFEIEELNRKYEQAKNISQDLEKQAARVHEEAKRAG
DKAVEIYASVAQLSPLDSETLENEANNIKMEAENLERLIDQKLKDYEDLREDMRGKELEV
KNLLEKGKTEQQTADQLLARADAAKALAEEAAKKGRDTLQEANDILNNLKDFDRRVNDNK
TAAEEALRKIPAINQTIIEANEKTREAQQALGNAAADATEAKNKAHEAERIASAVQKNAT
STKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAEI
NARKAKNSVTSLLSIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSDL
ENEAKKQEAAIMDYNRDIEEIMKDIRNLEDIRKTLPSGCFNTPSIEKP
NT seq 4827 nt NT seq  +upstreamnt  +downstreamnt
atgagggggagccagcgggccgcgccgnccctgcggcgccgggggcggctctggcccgtg
ttggccgtgctggcggccgccgcggcgggctgtgcccaggcagccatggacgagtgcacg
gacgagggcgggcggccgcagcgctgcatgcccgagttcgtcaacgccgccttcaacgtg
accgtggtggctaccaacacgtgtgggactccgcccgaggagtactgtgtgcagaccggg
gtgaccggggtcaccaagtcctgtcacctgtgcgacgccgggcagccccacctgcagcac
ggggcagccttcctgaccgactacaacaaccaggccgacaccacctggtggcaaagccag
accatgctggccggggtgcagtaccccagctccatcaacctcacgctgcacctgggaaaa
gcttttgacatcacctatgtgcgtctcaagttccacaccagccgcccagagagctttgcc
atttacaaacgcacgcgggaagatgggccctggattccttaccagtactacagtggttcc
tgcgagaacacctactccaaggcaaaccgcggcttcatcaggacaggaggggacgagcag
caggccttgtgtactgatgaattcagtgacatttctcccctcactgggggcaacgtggcc
ttttctaccctggaaggaaggccaagtgcctataactttgacaatagccctgtgctgcag
gaatgggtaactgccactgacatcagagtaactcttaatcgcctgaacacttttggagat
gaagtgtttaacgatcccaaagttctcaagtcctattattatgcgatctctgattttgct
gtgggtggcagatgtaaatgtaatggacacgcaagcgagtgtatgaagaacgaatttgat
aagctggtgtgtaactgcaaacataacacatatggagtagactgtgaaaagtgtcttcct
ttcttcaatgaccggccatggaggagggcaactgcagaaagtgccagtgaatgcctgccc
tgtgactgcaatggtcgatcccaggaatgctacttcgaccctgaactctatcgttctact
ggccatgggggtcactgtaccaactgccaggataacacagatggcgcccactgtgagagg
tgccgggagaacttcttccgccttggaaacaatgaagcctgctctccatgccactgtagt
cctgtgggctctctaagcacacagtgtgatagttacggcagatgcagctgtaagccagga
gtaatgggggacaaatgtgaccgttgccagcctggattccattctctcactgaggcagga
tgcaggccatgctcttgtgatccctctggcagcatagatgaatgtaatgttgaaacagga
agatgtgtttgcaaagacaatgtcgaaggcttcaattgtgaaagatgcaaacctggattt
tttaatctggaatcatctaatcctaggggttgcacaccctgcttctgctttgggcattct
tctgtctgtacaaatgctgttggctacagtgtttattctatctcctcttcctttcagatt
gatgaggatgggtggcgtgtggaacagagagatggctctgaagcatctctggaatggtcc
tctgagaggcaagatattgccgtgatctcagacagctactttcctaggtacttcattgct
cctgcaaagttcttgggcaagcaggtgttgagttatggtcagaacctctccttctccttt
cgagtggacaggcgagatactcgcctctctgcagaagaccttgtgcttgagggagctggc
ttaagagtatctgtgcccttgatcgctcagggcaattcctatccgagtgagaccactgtg
aagtatgtcttcaggctccatgaagcaacagattacccttggaggcctgctcttacccct
tttgaatttcagaagctcctgaacaacttgacctctatcaagatccgtgggacatacagt
gagagaagtgctggatatttggatgatgtcaccctggcaagtgctcgtcctgggcctgga
gtccctgcaacttgggtggagtcctgcacctgtcctgtgggatatggagggcagttttgt
gagatgtgcctttcaggttacagaagagaaactcctagtcttggaccatacagtccatgt
gtgctttgcacctgcaatggacacagcgagacctgtgatcctgagacaggtgtttgtaac
tgcagagacaatacggctggcccgcactgtgagaagtgcagtgatgggtactatggagat
tcaactgcaggaacctcctctgattgccagccctgtccgtgtcccggaggctcaagttgt
gctgttgtccccaagacaaaagaggtggtgtgcaccaactgtcctactggcaccactggt
aagagatgtgagctctgtgatgatggctactttggagaccccctaggtagaaacggccct
gtgagactttgccgcctgtgccagtgcaatgacaacattgatcccaacgcagttggaaat
tgcaatcgcttgacaggagaatgcctgaagtgcatctataatactgctggcttctattgt
gaccggtgcaaagacggattttttggaaatcccctggctcccaatccagcagacaaatgc
aaagcctgcagttgcaatccgtatgggacagtgaagcagcagagcaactgtaaccccgtg
acggggcaatgtgaatgtttgcctcatgtgactggccgggactgtggtgcttgcgaccct
ggattctacaacctgcagagtgggcagggctgtgagaggtgtgactgccatgccttgggc
tccaccaatgggcagtgtgacatccgcaccggccagtgtgagtgccagcctggcatcacc
ggtcagcactgtgagcgctgtgaggtcaaccactttgggtttggacctgaaggctgcaaa
ccctgtgactgtcatcccgaggggtctctttcacttcagtgcaaagacgatggtcactgt
gaatgcagagaaggctttgtgggaaatcgctgtgaccagtgtgaagaaaactatttctac
aatcggtcttggcctggctgccaggaatgtccagcttgttaccgtttggtaaaggataag
gttgctgatcatcgagtgaaactccaggaattagagagtctcatagcaaaccttggaact
ggggatgagatggtgacggatcaagccttcgaggatagactaaaggaagcagagagggaa
gttatggacctccttcgtgaggcccaggatgtcaaagatgttgaccagaatttgatggat
cgcctacagagagtgaataacagtctgtccagccaaattagccgtttacaaaatatccgg
aataccattgaagagactggaaacttggctgaacaagcacgtgcccatgtagagaacaca
gagaggttgattgaaatcgcgtccagagaacttgaaaaagcaaaagtagctgctgccaat
gtgtcagtcactcagccagaatctacaggggacccaaacaacatgactcttttggcggaa
gaggctcgaaagcttgctgaacgtcataaacaggaagctgatgacattgttcgagtggca
aagacagccaatgatacatcaactgaggcatacaacctgcttttgaggacattggcagga
gaaaatcaaacagcatttgagattgaagagcttaataggaagtatgaacaagcgaagaac
atctcacaagatctggaaaaacaagctgcccgagtacatgaggaggccaaaagggccggt
gacaaagctgttgagatctatgccagcgtggctcagctgagccctttggactctgagaca
ctggagaatgaagcaaataacataaagatggaagctgagaatctggaacgtctgattgac
cagaagttgaaagattatgaggacctcagagaagacatgagagggaaggaacttgaagtc
aagaaccttctggagaaaggaaagactgaacagcagaccgcagaccaactcctagcccga
gctgacgctgccaaggccctcgccgaagaggctgcaaagaagggacgtgataccttacaa
gaagctaatgacattctcaacaacctgaaagattttgataggcgcgtgaacgataacaag
acggccgcagaggaggcactaaggaagattcctgccatcaaccagaccatcattgaagcc
aatgaaaagaccagggaagcccagcaggccctgggcaacgctgcggcggacgccacagag
gccaagaacaaggcccatgaggcggagaggatcgcgagcgctgtccaaaagaatgccacc
agcactaaggcagaagctgaaagaacttttgcagaagttacagatctggataatgaggtg
aacaatatgttgaagcaactacaggaagcagaaaaagagctaaagcgaaaacaagatgac
gctgaccaggacatgatgatggcagggatggcttcacaggctgctcaagaagccgagatc
aatgccagaaaagccaagaactctgttactagcctcctcagcattattaatgacctcttg
gaacagctggggcagcttgacacagtggacctgaataagctaaacgagattgaaggcacc
ctaaacaaagccaaagatgaaatgaaggtcagcgatcttgataggaaagtgtctgacctg
gagaatgaagccaagaagcaggaggctgccatcatggactataatcgggatatcgaggag
atcatgaaggacattcgcaatctggaagacatcaggaagaccttaccatctggctgcttc
aacaccccgtccattgaaaagccctag

DBGET integrated database retrieval system