KEGG   Macaca mulatta (rhesus monkey): 715474Help
Entry
715474            CDS       T01028                                 

Gene name
GPX7
Definition
glutathione peroxidase 7 (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mcc00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:mcc00480]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:mcc04918]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 184 aa AA seqDB search
MVAAAAWLLLWAVACAQREQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQH
YRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGT
GAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILRK
REDL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggtggcggcggcggcgtggctgctcctgtgggctgtggcctgcgcgcagcgggagcag
gacttctacgacttcaaggcggtcaacatccggggcaaactggtgtcgctggagaagtac
cgcggctcggtatccctggtggtgaatgtggccagcgagtgcggcttcacagaccagcac
taccgagccctgcagcagctgcagcgggacctgggtccccaccacttcaacgtactcgcc
ttcccctgcaaccagtttggccaacaggagcctgacagcaacaaggagattgagagcttt
gcccgccgcacctacagtgtctcattccccatgtttagcaagattgcagtcaccggtact
ggtgcccatcctgccttcaagtacctggcccagacttctgggaaggagcccacctggaac
ttctggaagtaccttgtagccccagatggaaaggtggtaggggcttgggacccaactgtg
tcagtggaggaggtcagaccccagatcacagcgctcgtgaggaagctcatcctacggaag
cgagaagacttataa

DBGET integrated database retrieval system