KEGG   Macaca mulatta (rhesus monkey): 715523Help
Entry
715523            CDS       T01028                                 

Gene name
USP8
Definition
ubiquitin specific peptidase 8 (EC:3.4.19.12)
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    715523 (USP8)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     715523 (USP8)
Peptidases [BR:mcc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   715523 (USP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 1118 aa AA seqDB search
MPAVASVPKELYLSSSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECRLDRDEERAY
VLYMKYVTVYNLIKKRPDFKQQQDYFHSVLGPANIKKAVEEAERLSESLKLRYEEAEVRK
KLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEK
GAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHSLSVPEEAISPGVTASWIEAHLP
DDSKDTWKKRGNVEYVVLLDWFSSAKDLQIGTVLRSLKDALFKWESKTILRNEPLVLEGG
YENWLLCYPQYTTNAKVTPPPRRQNEEVSISLDFTYPSLEESVPSKPAAQIPPPSIEVDE
NIELISDQNERMGPLNISTPAEPVAASKSDVSPIIQPVPSIKNIPQIDRTKKPAVKLPEE
HRTKSESTNHEQQSPQNGKVIPDRSTKPVVFSPTLMLTDEEKARIHAETALLMEKNKQEK
ELRERQQEEQKEKLRREEQEQKTKKKQEAEENEITEKQQKAKEEMEKKESEQAKKEDKET
SAKRGKEITGVKRQSKSEHETSDAKKSVEDRGKRCPTPEVQKKSTGDVPHTSATGDSGSS
KPFKIKGQPESGILRTGTFREDTDDTERNKAQREPLTRARSEEMGRIVPGLPSGWAKFLD
PITGTFRYYHSPTNTVHMYPPEMAPSSAPPSTPPTHKAKPQIPAERDREPSKLKRSYSSP
DITQAIQEEEKRKPTVTPTVNRENKPTCYPKAEISRLSASQIRNLNPVFGGSGPALTGLR
NLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTG
QYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNEH
LDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTS
KCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRW
KQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRW
FKFDDHEVSDISVSSVKSSAAYILFYTSLGPRVTDVAT
NT seq 3357 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctgtggcttcagttcctaaagaactctacctcagttcttcactaaaagacctc
aataagaagacggaagttaaaccagagaaaataagcactaagagttatgtgcacagtgcc
ctgaagatctttaagacagcagaagaatgcagattagatcgtgatgaggaaagggcctat
gtgctatatatgaaatacgtgactgtttataatcttatcaaaaaaagacctgatttcaag
caacagcaggattatttccattcagttcttggacctgcaaacatcaaaaaagccgttgaa
gaagccgaaagactctctgaaagccttaaactaagatatgaagaagccgaagtccggaaa
aaacttgaggaaaaggacaggcaggaggaagcacagcggctacaacagaaaagacaggaa
acaggaagagaggatggtggcacgttggctaaaggttctttggagaatgtattggattcc
aaagacaaaacccaaaagagcaatggtgaaaagaatgaaaaatgtgagaccaaagagaaa
ggagcaatcacagcaaaggaactatacacaatgatgacggataaaaacatcagcttgatt
ataatggatgctcgaagaatgcaggattatcaggattcctgtattttacattctctcagt
gttcctgaagaagccatcagtccaggagtcactgctagttggattgaagcacacctccca
gatgattctaaagacacatggaagaagagggggaatgtggagtatgtggtacttcttgac
tggtttagttctgccaaagatttacagattggaacagttctccggagtctgaaagatgca
cttttcaagtgggaaagtaaaactatcctgcgcaatgagcctttggttttagagggaggc
tatgaaaactggctcctttgttatccccagtatacaacaaatgctaaggtcactccaccc
ccacgacgccagaatgaagaggtgtctatctcattggattttacttatccctcattggaa
gaatcagttccttctaaacctgctgcccagataccacctccatctatagaagtagatgaa
aatatagaattgataagtgatcaaaatgagagaatgggaccactgaatatatcaactcca
gctgaaccagttgctgcttctaaatctgatgtttcacccataattcagccagtgcctagt
ataaagaatattccacagattgatcgtactaaaaaaccagcagtcaaattgcctgaagag
catagaacaaaatctgaaagtacaaaccatgagcaacaatctcctcagaatggaaaagtt
attcctgatcgttccaccaagccagtagttttctctccaactctcatgttaacagatgaa
gaaaaggctcgtattcatgcagaaactgctcttctaatggagaaaaacaaacaagaaaaa
gaacttcgggaaaggcagcaagaggaacagaaagagaaactgaggagggaagaacaagaa
caaaaaaccaaaaagaaacaagaagctgaagaaaatgaaattacagagaagcaacaaaaa
gcaaaagaagaaatggagaagaaagaaagtgaacaggccaagaaagaagataaagaaacc
tcagcaaagaggggcaaagaaataacaggagtaaaaagacaaagtaaaagtgaacatgaa
acttctgatgccaagaaatctgtagaagacagggggaaaaggtgtccaaccccagaagta
cagaagaagtcaacaggagatgtgccccatacatctgcgacaggggattcgggttcaagc
aagccatttaagattaaaggacaaccagaaagtggaattctaaggacaggaacttttaga
gaggatacagacgataccgaaagaaataaagctcaacgagaacctttgacaagagcacga
agtgaagaaatgggaaggattgtaccaggactgccttcaggctgggccaagtttcttgac
ccaatcactggaacctttcgttattatcattcacccaccaacactgttcatatgtaccca
ccggaaatggctccttcatctgcacctccttccacccctccaactcataaagccaagcca
cagattcctgctgagcgggatagggaaccttccaaactgaagcgttcctactcctcccca
gatataacccaggctattcaggaggaagagaagaggaagccaacagtaactccaacggtt
aatcgagaaaacaagccaacatgttatcctaaagctgagatctcaaggctttctgcttct
cagattcggaacctcaatcctgtttttggaggttctggaccagctcttactggacttcgt
aacttaggaaatacttgttatatgaactcaatattgcagtgcctatgtaatgctccacat
ttggctgattatttcaaccgaaactgttatcaggatgatattaacaggtcaaatttgttg
gggcataaaggtgaagtggcagaagaatttggtataatcatgaaagccctgtggacagga
cagtatagatatatcagtccaaaagactttaaaatcaccattgggaagatcaatgaccag
tttgcaggatacagtcagcaagattcacaagaattgcttctgttcctgatggatggtctc
catgaagatctaaataaagctgataatcggaagagatataaagaagaaaataatgaacat
cttgatgactttaaagctgcagaacatgcctggcagaaacacaagcagctcaatgagtct
attattgttgcactttttcagggtcaattcaaatctacagtacagtgcctcacctgtcac
aaaaagtctaggacatttgaggccttcatgtatttgtctctgccgctagcatccacaagt
aaatgtacattacaggattgccttagattattttccaaagaagaaaaactcacagataac
aacagattttactgcagtcattgcagagctcgacgagattctctaaaaaagatagaaatc
tggaagttaccacctgtacttttagtgcatctgaaacgtttttcctacgatggcaggtgg
aaacaaaaattacagacatctgtggacttcccgttagaaaaccttgacttgtcacagtat
gttattggtccaaagaacaatttgaagaaatataatttgttttctgtttcaaatcactac
ggcggactggatggaggccactacacagcctattgtaaaaatgcagcaagacaacggtgg
tttaagtttgatgatcatgaagtttctgatatctccgtttcttctgtgaaatcgtcagca
gcttacatcctcttttatacttcactgggaccacgagtaactgatgtagccacataa

DBGET integrated database retrieval system