KEGG   Macaca mulatta (rhesus monkey): 715650Help
Entry
715650            CDS       T01028                                 

Gene name
CDK4
Definition
(RefSeq) cyclin dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc04110  Cell cycle
mcc04115  p53 signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04218  Cellular senescence
mcc04530  Tight junction
mcc04660  T cell receptor signaling pathway
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04934  Cushing's syndrome
mcc05161  Hepatitis B
mcc05162  Measles
mcc05165  Human papillomavirus infection
mcc05166  HTLV-I infection
mcc05167  Kaposi's sarcoma-associated herpesvirus infection
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
mcc05212  Pancreatic cancer
mcc05214  Glioma
mcc05218  Melanoma
mcc05219  Bladder cancer
mcc05220  Chronic myeloid leukemia
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
Module
mcc_M00692  Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    715650 (CDK4)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    715650 (CDK4)
   04115 p53 signaling pathway
    715650 (CDK4)
   04218 Cellular senescence
    715650 (CDK4)
  Cellular community - eukaryotes
   04530 Tight junction
    715650 (CDK4)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    715650 (CDK4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    715650 (CDK4)
   05203 Viral carcinogenesis
    715650 (CDK4)
   05212 Pancreatic cancer
    715650 (CDK4)
   05225 Hepatocellular carcinoma
    715650 (CDK4)
   05214 Glioma
    715650 (CDK4)
   05220 Chronic myeloid leukemia
    715650 (CDK4)
   05218 Melanoma
    715650 (CDK4)
   05219 Bladder cancer
    715650 (CDK4)
   05224 Breast cancer
    715650 (CDK4)
   05222 Small cell lung cancer
    715650 (CDK4)
   05223 Non-small cell lung cancer
    715650 (CDK4)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    715650 (CDK4)
   04934 Cushing's syndrome
    715650 (CDK4)
  Infectious diseases
   05166 HTLV-I infection
    715650 (CDK4)
   05162 Measles
    715650 (CDK4)
   05161 Hepatitis B
    715650 (CDK4)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    715650 (CDK4)
   05165 Human papillomavirus infection
    715650 (CDK4)
  Drug resistance
   01522 Endocrine resistance
    715650 (CDK4)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     715650 (CDK4)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CMGC group
  CDK family
   715650 (CDK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 715650
NCBI-ProteinID: NP_001248276
UniProt: I0FIZ0
Position
11
AA seq 303 aa AA seqDB search
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggctacctctcgatatgagccagtggctgaaattggtgtcggtgcctatgggacagtg
tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtgagagtcccc
aatggaggaggagctggaggaggccttcccatcagcacagttcgggaggtggccttactg
aggcgactggaggcttttgaacatcccaatgtagtccggctgatggacgtctgtgccaca
tcccgaactgaccgggagatcaaggtaaccctggtgtttgagcatgtagaccaagaccta
aggacgtatctggacaaagcacccccaccaggcttgccagccgagaccatcaaggatttg
atgcgccagtttctaagaggcctagatttccttcatgcaaattgcatcgttcaccgagat
ctgaagccagagaacattctggtgacaagtggtggaacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacacccgtggttgttacactctggtac
cgagctcccgaagttcttctgcagtccacatatgcaacacctgtggacatgtggagtgtt
ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct
gaccagttgggcaaaatctttgacctgattgggctgcctccagaggatgactggcctcga
gatgtatccctgccccgtggagcctttccccccagagggccccgcccagtgcagtcggtg
gtacctgagatggaggagtcgggagcacagctgctgctggaaatgctgacttttaaccca
cacaagcgaatctctgcctttcgagctctgcagcactcttatctacataaggatgaaggt
aatccggagtga

DBGET integrated database retrieval system