KEGG   Macaca mulatta (rhesus monkey): 715650Help
Entry
715650            CDS       T01028                                 

Gene name
CDK4
Definition
cyclin-dependent kinase 4 (EC:2.7.11.22)
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
Tight junction
T cell receptor signaling pathway
Hepatitis B
Measles
HTLV-I infection
Pathways in cancer
Viral carcinogenesis
Pancreatic cancer
Glioma
Melanoma
Bladder cancer
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    715650 (CDK4)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    715650 (CDK4)
   04115 p53 signaling pathway
    715650 (CDK4)
  Cellular commiunity
   04530 Tight junction
    715650 (CDK4)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    715650 (CDK4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    715650 (CDK4)
   05203 Viral carcinogenesis
    715650 (CDK4)
   05212 Pancreatic cancer
    715650 (CDK4)
   05214 Glioma
    715650 (CDK4)
   05220 Chronic myeloid leukemia
    715650 (CDK4)
   05218 Melanoma
    715650 (CDK4)
   05219 Bladder cancer
    715650 (CDK4)
   05222 Small cell lung cancer
    715650 (CDK4)
   05223 Non-small cell lung cancer
    715650 (CDK4)
  Infectious diseases
   05166 HTLV-I infection
    715650 (CDK4)
   05162 Measles
    715650 (CDK4)
   05161 Hepatitis B
    715650 (CDK4)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     715650 (CDK4)
Protein kinases [BR:mcc01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   715650 (CDK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
11
AA seq 303 aa AA seqDB search
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggctacctctcgatatgagccagtggctgaaattggtgtcggtgcctatgggacagtg
tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtgagagtcccc
aatggaggaggagctggaggaggccttcccatcagcacagttcgggaggtggccttactg
aggcgactggaggcttttgaacatcccaatgtagtccggctgatggacgtctgtgccaca
tcccgaactgaccgggagatcaaggtaaccctggtgtttgagcatgtagaccaagaccta
aggacgtatctggacaaagcacccccaccaggcttgccagccgagaccatcaaggatttg
atgcgccagtttctaagaggcctagatttccttcatgcaaattgcatcgttcaccgagat
ctgaagccagagaacattctggtgacaagtggtggaacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacacccgtggttgttacactctggtac
cgagctcccgaagttcttctgcagtccacatatgcaacacctgtggacatgtggagtgtt
ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct
gaccagttgggcaaaatctttgacctgattgggctgcctccagaggatgactggcctcga
gatgtatccctgccccgtggagcctttccccccagagggccccgcccagtgcagtcggtg
gtacctgagatggaggagtcgggagcacagctgctgctggaaatgctgacttttaaccca
cacaagcgaatctctgcctttcgagctctgcagcactcttatctacataaggatgaaggt
aatccggagtga

DBGET integrated database retrieval system