KEGG   Macaca mulatta (rhesus monkey): 715698Help
Entry
715698            CDS       T01028                                 

Definition
histone deacetylase 10-like
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Alcoholism
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    715698
  Substance dependence
   05034 Alcoholism
    715698
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     715698
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     715698
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 651 aa AA seqDB search
MGTALVYHEDMTATRLLWDDPECEIERPERLTAALDRLRQRGLEQRCLRLSAREASKEEL
GLVHSPEYVSLVRKTQVLGEEELQALSGQFDAIYFHPSTFHCARLAAGAGLQLVDAVLTG
AVQNGLALVRPPGHHSQRAAANGFCVFNNVAIAAAHAKQKHGLHRILIVDWDVHHGQGIQ
YLFEDDPSVLYFSWHRYEHGRFWPFLRESDADAVGRGQGLGFTVNLPWNQVGMGNADYVA
AFLHLLLPLAFEGQMQATPECFAHLTHLLQVLAGGRVCAMLEGGYHLESLAESVCMTVQA
LLGDPAPPLSGLMVPCQSALESIQSARAAQAPYWKSLQLQDVTPVPTSPSTHSPEGRPPP
LLPGGPMCKAAAPAPAPSSLLDQLCLCPAPSVRTTVALTAPDITLVLPPDVIQQEGSALR
EETEAWARPHESLAREEALTALGKLLYLLDGMLDGQVNSGIAATPASAAAATLDVAIQRG
LSHGAQRLLCVALGQLDRPPDLAHDGRTLWLNIGGKEAAALSMFHVATPLPVMTGGFLSC
ILGLVLPLAYGFQPDLVLVALGPGHGLQGPHAALLAAMLRGLAGGRVLALLEEDSTPQLA
GILARVLRGEAPPSLGPSSVASPEDVQALMYLRGQLEPQWKMLQCRPHLVV
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atggggaccgcgcttgtgtaccatgaggacatgacggccacccggctgctctgggacgac
cccgagtgcgagattgagcgccctgagcgcctgaccgcagccctggaccgcctgcggcag
cgcggcctggaacagaggtgtctgcggttgtcagcccgcgaggcctcgaaagaggagctg
ggcctggtgcacagcccagagtatgtgtccctggtcaggaagacccaggtcctaggcgag
gaggagctgcaagcgctgtccggacagttcgacgccatctacttccacccgagtaccttt
cactgtgcacgcctggccgcaggggctggactgcagctggtggatgctgtgctcacggga
gctgtgcaaaacgggcttgctctggtgaggccccccgggcaccacagccagagggcagct
gccaacgggttctgcgtgttcaacaacgtggccatagcagctgcacatgccaagcagaag
cacgggctacacaggatcctcatcgtggactgggatgtgcaccatggccaggggatccag
tatctctttgaggatgaccccagcgtcctttacttctcctggcaccgctatgagcatggg
cgtttctggcctttccttcgagagtcagatgcagacgcagtggggcggggacagggcctc
ggcttcactgtcaacctgccctggaaccaggtcgggatgggaaacgctgactacgtggct
gccttcctgcacctgctgctcccactggcctttgaggggcaaatgcaggccacgccagag
tgcttcgcccacctcacacatctgctgcaggtgctggccggcggccgggtctgcgccatg
ctggagggcggctaccacctggagtcactggctgagtcagtgtgcatgacagtacaggcg
ctgctgggcgacccggctccacccctgtcagggctcatggtgccatgtcagagtgccctg
gagtccatccagagtgcccgtgctgcccaagccccgtactggaagagcctgcagctgcaa
gatgtgacccctgtgccgacgagccccagcacccactccccagaggggaggcctccacct
ctgctgcctgggggtcccatgtgtaaggcagctgcacctgcacctgcaccgagctccctc
ctggaccagctgtgcctctgccctgcaccctctgtccgcaccaccgttgccctgacagcg
ccagatatcacactggtcctgccccctgatgtcatccaacaggaagggtcagccctgagg
gaggagacagaagcctgggccaggccacatgagtccctggcccgggaggaggccctcact
gcacttgggaagctcctgtacctcttagatgggatgctggatgggcaggtgaacagtggc
attgcagccactccagcctctgctgcagcagccaccctggatgtggctattcagagaggc
ctgtcccacggagcccagaggctgctgtgtgtggccctgggacagctggaccggcctcca
gacctcgcccatgacgggaggactctgtggctgaacatcgggggcaaggaggcagccgcc
ctatccatgttccatgtcgccacgccactgccagtgatgactggtggcttcctgagctgc
atcttgggcttggtactgcccctggcctatggcttccagcctgacctggtgctagtggcg
ctagggcctggccatggcctgcagggcccccacgctgcactcctggctgccatgcttcgg
ggactggcagggggccgagtcctggccctcctggaggaggactccacaccccagctagca
gggatcctggcccgggtgctgcgtggagaggcacctcctagcctaggcccttcctctgtg
gcctccccggaggacgtccaggctctgatgtacctgagagggcagctggagcctcagtgg
aagatgctgcagtgccgtcctcacctggtggtttga

DBGET integrated database retrieval system