KEGG   Macaca mulatta (rhesus monkey): 715880Help
Entry
715880            CDS       T01028                                 

Gene name
KAT5, HTATIP
Definition
K(lysine) acetyltransferase 5
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    715880 (KAT5)
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     715880 (KAT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
14
AA seq 475 aa AA seqDB search
MAEVVSPVPGAGRREPGEVGRARGPPVADPGAALSPQGEIIEGCRLPVLRRNQDNEDEWP
LAEILSVKDISGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGLPGSR
PGSPEREVPASAQASGKTLPIPVQITLRFNLPKEREAIPGGEPDQPLSSSSCLQPNHRST
KRKVEVVSPATPVPSETAPASVFPQNGAARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIP
SAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCL
KYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHK
TLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIE
FSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMGLKSESGERPQITIK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtggtgagtccggtgcccggggcggggcggagggagccaggggaggtgggt
agagcccgaggccccccagtagccgaccctggcgccgcgctgtctccccagggggagata
atcgagggctgccgcctacccgtgctgcggcggaaccaggacaacgaagatgagtggccc
ctggccgagatcctgagcgtgaaggacatcagtggccggaagcttttctacgtccattac
attgacttcaacaaacgtctggatgaatgggtgacgcacgagcggctggacctaaagaag
atccagttcccgaagaaagaggccaagacccccaccaagaacggacttcctgggtcccgt
cccggctctccagagagagaggtgccggcctcggcccaggcaagcgggaagaccttgcca
atcccggtccagatcacactccgcttcaacctgcccaaggagcgggaggccattcccggt
ggcgagcctgaccagccgctctcctccagctcctgcctgcagcccaaccaccgctcaacg
aaacggaaggtggaggtggtttcaccagcaactccagtgcccagcgagacagccccggcc
tcggtttttccccagaatggagcagcccgtagggcagtggcagcccagccaggacggaag
cgaaaatcgaattgtttgggcactgatgaggactcccaggacagctcagatggaatacca
tcagcaccacgcatgactggcagcctggtgtctgaccgaagccacgacgacatcgtcacc
cggatgaagaacatcgagtgcattgagctgggccggcaccgcctcaagccgtggtacttc
tccccgtacccacaggagctcaccacattgcctgttctctacctgtgcgagttctgcctc
aagtacggccgtagcctcaagtgtcttcagcgtcacttgaccaagtgcgacctacgacat
cctccaggcaatgagatttaccgaaagggcaccatctccttctttgagattgatggacgt
aagaacaagagttattcccagaacctgtgtcttttggccaagtgtttccttgaccataag
acactgtactatgacacagaccctttcctcttctacgtcatgacggagtatgactgtaag
ggcttccacatcgtgggctacttctccaaggagaaagaatcgacagaagactacaatgtg
gcctgcatcctaaccctgcctccctaccagcgccggggctacggcaagctgctgatcgag
ttcagctatgaactctccaaagtggaagggaaaacagggacccctgagaagcccctctca
gaccttggcctcctatcctatcgaagttactggtcccagaccatcctggagatcctgatg
gggctgaagtcagagagcggggagaggccacagatcaccatcaagtga

DBGET integrated database retrieval system