KEGG   Macaca mulatta (rhesus monkey): 715919Help
Entry
715919            CDS       T01028                                 

Gene name
RELA
Definition
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  transcription factor p65
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01523  Antifolate resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04137  Mitophagy - animal
mcc04151  PI3K-Akt signaling pathway
mcc04210  Apoptosis
mcc04211  Longevity regulating pathway
mcc04218  Cellular senescence
mcc04380  Osteoclast differentiation
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04657  IL-17 signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04668  TNF signaling pathway
mcc04722  Neurotrophin signaling pathway
mcc04917  Prolactin signaling pathway
mcc04920  Adipocytokine signaling pathway
mcc04926  Relaxin signaling pathway
mcc04931  Insulin resistance
mcc04932  Non-alcoholic fatty liver disease (NAFLD)
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc05030  Cocaine addiction
mcc05132  Salmonella infection
mcc05133  Pertussis
mcc05134  Legionellosis
mcc05140  Leishmaniasis
mcc05142  Chagas disease (American trypanosomiasis)
mcc05145  Toxoplasmosis
mcc05146  Amoebiasis
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05166  HTLV-I infection
mcc05167  Kaposi's sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex infection
mcc05169  Epstein-Barr virus infection
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05203  Viral carcinogenesis
mcc05212  Pancreatic cancer
mcc05215  Prostate cancer
mcc05220  Chronic myeloid leukemia
mcc05221  Acute myeloid leukemia
mcc05222  Small cell lung cancer
mcc05321  Inflammatory bowel disease (IBD)
mcc05418  Fluid shear stress and atherosclerosis
Module
mcc_M00686  Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    715919 (RELA)
   04010 MAPK signaling pathway
    715919 (RELA)
   04064 NF-kappa B signaling pathway
    715919 (RELA)
   04668 TNF signaling pathway
    715919 (RELA)
   04066 HIF-1 signaling pathway
    715919 (RELA)
   04071 Sphingolipid signaling pathway
    715919 (RELA)
   04024 cAMP signaling pathway
    715919 (RELA)
   04151 PI3K-Akt signaling pathway
    715919 (RELA)
 Cellular Processes
  Transport and catabolism
   04137 Mitophagy - animal
    715919 (RELA)
  Cell growth and death
   04210 Apoptosis
    715919 (RELA)
   04218 Cellular senescence
    715919 (RELA)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    715919 (RELA)
   04621 NOD-like receptor signaling pathway
    715919 (RELA)
   04622 RIG-I-like receptor signaling pathway
    715919 (RELA)
   04623 Cytosolic DNA-sensing pathway
    715919 (RELA)
   04625 C-type lectin receptor signaling pathway
    715919 (RELA)
   04660 T cell receptor signaling pathway
    715919 (RELA)
   04658 Th1 and Th2 cell differentiation
    715919 (RELA)
   04659 Th17 cell differentiation
    715919 (RELA)
   04657 IL-17 signaling pathway
    715919 (RELA)
   04662 B cell receptor signaling pathway
    715919 (RELA)
   04062 Chemokine signaling pathway
    715919 (RELA)
  Endocrine system
   04920 Adipocytokine signaling pathway
    715919 (RELA)
   04917 Prolactin signaling pathway
    715919 (RELA)
   04926 Relaxin signaling pathway
    715919 (RELA)
  Nervous system
   04722 Neurotrophin signaling pathway
    715919 (RELA)
  Development
   04380 Osteoclast differentiation
    715919 (RELA)
  Aging
   04211 Longevity regulating pathway - mammal
    715919 (RELA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    715919 (RELA)
   05202 Transcriptional misregulation in cancers
    715919 (RELA)
   05203 Viral carcinogenesis
    715919 (RELA)
   05212 Pancreatic cancer
    715919 (RELA)
   05221 Acute myeloid leukemia
    715919 (RELA)
   05220 Chronic myeloid leukemia
    715919 (RELA)
   05215 Prostate cancer
    715919 (RELA)
   05222 Small cell lung cancer
    715919 (RELA)
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    715919 (RELA)
  Substance dependence
   05030 Cocaine addiction
    715919 (RELA)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    715919 (RELA)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    715919 (RELA)
   04931 Insulin resistance
    715919 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    715919 (RELA)
  Infectious diseases
   05132 Salmonella infection
    715919 (RELA)
   05133 Pertussis
    715919 (RELA)
   05134 Legionellosis
    715919 (RELA)
   05152 Tuberculosis
    715919 (RELA)
   05166 HTLV-I infection
    715919 (RELA)
   05162 Measles
    715919 (RELA)
   05164 Influenza A
    715919 (RELA)
   05161 Hepatitis B
    715919 (RELA)
   05160 Hepatitis C
    715919 (RELA)
   05168 Herpes simplex infection
    715919 (RELA)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    715919 (RELA)
   05169 Epstein-Barr virus infection
    715919 (RELA)
   05165 Human papillomavirus infection
    715919 (RELA)
   05146 Amoebiasis
    715919 (RELA)
   05145 Toxoplasmosis
    715919 (RELA)
   05140 Leishmaniasis
    715919 (RELA)
   05142 Chagas disease (American trypanosomiasis)
    715919 (RELA)
  Drug resistance
   01523 Antifolate resistance
    715919 (RELA)
Transcription factors [BR:mcc03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    715919 (RELA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHD_DNA_bind RHD_dimer
Motif
Other DBs
NCBI-GeneID: 715919
NCBI-ProteinID: XP_014969261
Ensembl: ENSMMUG00000007418
UniProt: A0A1D5R3L5
Position
14
AA seq 543 aa AA seqDB search
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAITQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSVVPKPAPQPYPFTSSLSTINYD
EFPTMVFPSGQISQASALAPPQVLPQAPAPAPAPAMVSPLAQAPVLAPGPPQAVAPPAPK
PTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPTVFTDLASVDNSEFQQLLNQGVPVAPH
TTEPMLMEYPEAITRLVTAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQ
ISS
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggacgaactgttccccctcatcttcccggcagagccagcccaggcctctggcccttat
gtggagatcattgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggg
cgctccgcgggcagcatcccaggcgagaggagcacagataccaccaagacccaccccacc
atcaagatcaatggctacacaggaccagggacagtacgcatctccctagtcaccaaggac
cctcctcaccggcctcacccccacgagcttgtaggaaaggactgccgggatggcttctat
gaggctgagctctgcccggaccgctgcatccacagtttccagaacctgggaatccagtgt
gtgaagaagcgggacctggagcaggctatcactcagcgcatccagacgaacaacaatccc
ttccaagttcctatagaagaacagcgtggggactacgacctgaatgctgtgcggctctgc
ttccaggtgacagtgcgggatccatcaggcaggcccctccgcctgccgcctgtcctttct
catcccatctttgacaaccgtgcccccaacactgccgaactcaagatctgccgagtgaac
cgaaactctggcagctgcctcggtggggatgagatcttcctactgtgtgacaaggtgcag
aaagaggacattgaggtgtatttcacgggaccaggctgggaggcccgaggctccttttca
caagctgatgtgcaccgacaagtggccattgtgttccggacccctccctacgcagacccc
agcctgcaggctcccgtgcgtgtctccatgcagctgcggcggccttccgaccgggagctc
agtgagcccatggaattccagtacctgccagatacagacgatcgtcaccggattgaggag
aaacgcaaaaggacatatgagaccttcaagagcatcatgaagaagagtcctttcagcgga
cccactgacccccggcctccacctcggcgcattgctgtgccttcccgcagctcagttgtt
cccaagccagcaccccagccctatccctttacgtcatccctgagcaccatcaactatgat
gagtttcccaccatggtgtttccttctgggcagataagccaggcctcagccttggcccct
ccccaagtcctgccccaggctccagcccctgcccctgctccagccatggtatcacctctg
gcccaggccccagtcctagccccaggccctcctcaggctgtggccccacctgcccccaag
cccacccaggctggggaaggaacgctgtcagaggccttgctgcagctgcagtttgatgat
gaagacctgggggccttgcttggcaacagcacagacccaaccgtgttcacagacctggca
tcagtcgacaactccgagtttcagcagctgctgaaccagggcgtacctgtggccccccac
acaactgagcccatgctgatggagtaccctgaggctataactcgcctagtgacggcccag
aggccccctgacccagctcctgctccactgggggccccggggctccccaacggcctcctt
tcaggagatgaagacttctcctccattgcggacatggacttctcagccctgctgagtcag
atcagctcctaa

DBGET integrated database retrieval system