KEGG   Macaca mulatta (rhesus monkey): 715924Help
Entry
715924            CDS       T01028                                 

Gene name
PLCD3
Definition
phospholipase C, delta 3
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mcc00562]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:mcc04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:mcc04070]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:mcc04919]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
16
AA seq 785 aa AA seqDB search
MLCGRWRRCRRPPEEPPVAAQVAAPVALPSPPTPSDGGTKRPGLRALKKMGLTEDEDVRA
MLLGSRLRKIRSRTWHKERLYRLQEDGLSVWFQRRIPRAPSQHIFFVQHIEAVREGHQSE
GLRRFGGAFAPARCLTIAFKGRRKNLDLAAPTAEEAQRWVRGLTKLRARLDAMSQRERLD
HWIHSYLHRADSNQDSKMSFKEIKSLLRMVNVDMNDMYAYLLFKECDHSNNDRLEGAEIE
EFLRRLLKRPELEEIFHQYSGEDRVLSAPELLEFLEDQGEEGATLARAQQLIQTYELNET
AKQHELMTLDGFMMYLLSPEGAALDTTHTCVFQDMNQPLAHYFISSSHNTYLTDSQIGGP
SSTEAYIRAFAQGCRCVELDCWEGPGGEPIIYHGHTLTSKILFRDVVQAVRDHAFTLSPY
PVILSLENHCGLEQQAAMARHLRTILGDMLVTQALDSPNPEELPSPEQLKGRVLVKGKKL
PAARSEDGRALSDREEEEDDDEEEEEEAETAAQRRLAKQISPELSALVVYCHATRLRTLH
PAPDAPQPCQVSSLSERKAKKLIREAGNSFVRHNARQLTRVYPLGLRMNSANYSPQEMWN
SGCQLVALNFQTPGYEMDLNAGRFLVNGQCGYVLKPACLRQPDSTFDPEDPGPPRTTLSI
QVLTAQQLPKLNAEKPHSIVDPLVRVEIHGVPADCARQETDYVLNNGFNPHWGQTLQFQL
RAPELALVRFVVEDYDATSPNDFVGQFTLPLSSLKQGYRHIHLLSKDGASLSPATLFIQI
RIQHP
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgcggccgctggaggcgctgccgccgcccgcccgaggagcccccggtagccgcc
caagtcgcggcgccggtcgcgctcccgtccccgccgactccctccgatggcggcaccaag
aggcccgggctgcgggcgctgaagaagatgggcctgacggaggacgaggacgtgcgcgcc
atgctgctgggctcccggctccgcaagatccgctcgcgcacgtggcacaaggagcggctg
taccggctgcaggaggacggcctgagcgtgtggttccagcggcgcatcccgcgcgcgccg
tcgcagcacatcttctttgtgcagcacatcgaggcagtccgcgagggccaccagtccgag
ggcctgcggcgcttcgggggtgccttcgccccggcgcgctgcctcaccatcgccttcaag
ggccgccgcaagaacctggacctggcggcgcccacggctgaggaagcgcagcgctgggtg
cgcggtctgaccaagctccgcgcgcgcctggacgccatgagccagcgcgagcggctggac
cactggatccactcgtatctgcaccgggctgactccaaccaggacagcaagatgagcttc
aaggagatcaagagcctgctgagaatggtcaacgtggacatgaacgacatgtacgcctac
ctcctcttcaaggagtgtgaccactccaacaatgaccgtctagagggggctgagattgag
gagttcctgcggcggctgctgaagcggccggagctggaggagatcttccatcagtactcg
ggcgaggaccgcgtgctgagtgcccctgagctgctggagttcctggaggaccagggcgag
gagggcgccacgctggcccgcgcccagcagctcattcagacctacgagctcaacgagaca
gccaagcagcacgagctgatgacactggatggcttcatgatgtacctgttgtcgccggag
ggggctgccttggacaccacccacacgtgtgtgttccaggacatgaaccagcccctcgcc
cactacttcatctcttcctcccacaacacctatctgaccgactcccagattggggggccc
agcagcaccgaggcctacattagggcctttgcccagggatgccgctgtgtggagctggac
tgctgggaggggccaggaggggagcccatcatctatcacggacatactctcacctccaag
attctcttccgggatgtggtccaagccgtgcgtgaccatgccttcacgctgtccccctac
cctgtcatcctatccctggagaaccactgcgggctggagcagcaggctgccatggcccgc
cacctccgcaccatcctaggggacatgctggtgacacaggcgctggactccccaaatcct
gaggagctgccttccccagagcagctgaagggccgggtcctggtgaaggggaagaagctg
cctgctgctcggagcgaggatggccgggctctgtcggacagggaggaggaggaggacgat
gacgaggaggaagaagaggaggcggagactgcagcacagaggcggctggctaagcagatc
tccccggagctgtcggccctggtcgtgtactgccacgccacccgcctgcggaccctgcac
cctgcccctgacgccccgcagccctgccaggtcagctccctcagcgagcgcaaagccaag
aaactcatccgggaagcagggaacagcttcgtcaggcacaatgcccgccagctgacccgc
gtgtacccgctggggctgcggatgaactcggccaactatagtccccaggagatgtggaac
tcgggctgtcagctggtggccttgaacttccagacgccaggctacgagatggacctcaat
gccggccgcttcctggtcaatgggcagtgtggctacgtcctgaaacctgcctgcctgcgg
caacctgactcgacctttgaccctgaggacccgggacctcccagaaccactctcagcatc
caggtgctgactgcacagcagctgcccaagctgaacgccgagaagccacattccattgtg
gaccccctggtgcgcgttgagatccatggggtgcccgcagactgtgcccggcaggagact
gactatgtgctcaacaatggcttcaacccccactgggggcagaccctgcagttccagctg
cgggctccggagctggcgctggtccggtttgtggtggaagattatgacgccacctccccc
aatgactttgtgggccagtttacactgcctcttagcagcctaaagcaagggtaccgccac
atacacctgctttccaaggacggggcctcactgtcaccagctacgctcttcattcaaatc
cgcatccagcacccctga

DBGET integrated database retrieval system