KEGG   Macaca mulatta (rhesus monkey): 716036Help
Entry
716036            CDS       T01028                                 

Gene name
GEMIN7
Definition
gem (nuclear organelle) associated protein 7
Orthology
K13135  
gem associated protein 7
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
RNA transport
Module
Survival motor neuron (SMN) complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:mcc03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 131 aa AA seqDB search
MQTPVTIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLEFQEQRARA
ALREHYLRSLLAMVGRQVSFTLHEGVRVAAHFGATDLDVVNFYVSQLQTPIGVQAEALLR
CSDIISYTFKP
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactccagtgaccattcctgtacctgtgctccggctgccccggggccctgatggc
ttcagccgtggctttgcccctgatggacgcagagcccccctgaggccagaggttcctgaa
atccaggagtgtcccatagctcaagaatccctggaattccaggagcagcgggcccgagcc
gcccttcgggagcattacctccgcagcctgctggccatggtgggtcgtcaggtgagcttc
acgttgcacgagggtgtgcgtgtggccgcccacttcggagccaccgacctggatgtggtc
aacttctacgtgtcacagctgcagactcccataggtgtgcaagcagaggcgctgctccga
tgtagtgacattatttcatacaccttcaagccatag

DBGET integrated database retrieval system