KEGG   Macaca mulatta (rhesus monkey): 716128Help
Entry
716128            CDS       T01028                                 

Gene name
HEXDC
Definition
hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Other glycan degradation
Class
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:mcc00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
16
AA seq 492 aa AA seqDB search
MSGSTPFKMRLVHLDLKGAPPKVSYLSEIFPLFRALGANGLLIEYEDMFPYEGPLRLLRA
KYAYSPSEIKEILHLAGLNELEVIPLVQTFGHMEFVLKHAAFAHLREVGPFPCTLNPHEA
ESLALVGAMIDQVLELHPGARWLHVGCDEVYYLGEGEASRRWLQQEQNSTGKLCLSHMRA
VASHVQTQRPSVTPLVWDDMLRDLPEDQLAASGVPQLVEPVLWDYAADLDVHGKVLLMQK
YWRCGFPRLWAASAFKGATGPSQAVPPIRHHLRNHVQWLQVAGSRPTDSLQGIILTGWQR
YDHFSVLCELLPAGVPSLAACLQLLLHGGFDGDAKAKVENLLGISNLEMMDPVREGAGSF
PGSNILALVTQVSLHLRSSVDALLEGNTYVTGWFSPYHRRRKLIHPVMVQHIQPAALSLL
AQWSTLVRELEVALQLAFYPDAVEEWLEENVHPSLQRLQALLQDLSEVATPSPPPPPPPP
PTSPGRDTAQDP
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggttccacgccatttaagatgagattagttcatttagaccttaaaggagctcca
ccaaaggtctcatacctctcagagatttttcctctgttccgtgcgctaggtgcaaacggc
ctcctcattgagtatgaagacatgtttccctacgagggccctctgagactgctgagggcc
aagtacgcctacagcccctctgaaatcaaagaaatcctgcatctggctggactcaatgag
ctggaggtgattcccttggtgcagacatttggacacatggagttcgtgctgaagcatgca
gccttcgcccacctgcgggaggtgggccccttcccctgcaccctgaacccccacgaggca
gagtccctggcactggtgggcgccatgatcgaccaggtcctggagctgcacccaggcgcc
cgatggctgcacgtcgggtgtgacgaggtctattacctcggagagggggaggcctcgcgc
cggtggctgcagcaagagcagaacagcacagggaagttgtgcctgtcacacatgcgggcg
gtggccagccacgtgcagacccagcgccccagcgtgacacccctggtgtgggacgacatg
ctccgagacctgcctgaggaccagctcgcagcatccggggtgccacagctggtggagccg
gtgctctgggactacgcggccgacctggatgtgcatggcaaggtcctcctcatgcagaag
tactggcggtgcggctttccgcggctgtgggcagccagtgccttcaagggtgccacaggg
cccagccaggccgtgccccccatcaggcaccacctcaggaaccatgtgcagtggctgcag
gtggcaggcagcaggcccacggactcactgcagggcatcatcctgaccggctggcagagg
tacgaccacttctctgtgctgtgcgagctgctccctgcaggagtcccgtccctggccgcc
tgtctacagttgcttctacacggaggatttgatggagatgctaaagcgaaagtggagaac
cttcttgggatttccaacctggagatgatggaccctgttagggagggggccggctctttc
cctggcagcaacatccttgcccttgtcacacaagtcagcctccatctgcgcagctctgtg
gacgcgctgctggagggcaacacgtacgtcaccggctggttcagcccctaccaccgccgg
cggaagctcatccacccggtcatggttcagcacatccagcccgcagcactcagcctcctg
gcgcagtggagcaccctcgtgcgggagctggaggtcgccctgcagctggctttctacccg
gatgccgtggaggagtggctggaggagaacgtgcaccccagcctgcagcggctgcaagct
ctactgcaggacctcagcgaggtggccaccccctcacccccacccccacccccaccccca
cccaccagccctggcagggacactgctcaggacccctga

DBGET integrated database retrieval system