KEGG   Macaca mulatta (rhesus monkey): 716170Help
Entry
716170            CDS       T01028                                 

Gene name
TP53
Definition
tumor protein p53
Orthology
K04451  
tumor protein p53
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Wnt signaling pathway
Neurotrophin signaling pathway
Thyroid hormone signaling pathway
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Hepatitis C
Hepatitis B
Measles
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Proteoglycans in cancer
MicroRNAs in cancer
Colorectal cancer
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Thyroid cancer
Basal cell carcinoma
Melanoma
Bladder cancer
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mcc04010]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:mcc04310]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:mcc04151]
Cellular Processes; Cell growth and death; Cell cycle [PATH:mcc04110]
Cellular Processes; Cell growth and death; Apoptosis [PATH:mcc04210]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:mcc04115]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:mcc04919]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:mcc04722]
Human Diseases; Cancers; Pathways in cancer [PATH:mcc05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:mcc05202]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:mcc05206]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:mcc05205]
Human Diseases; Cancers; Viral carcinogenesis [PATH:mcc05203]
Human Diseases; Cancers; Colorectal cancer [PATH:mcc05210]
Human Diseases; Cancers; Pancreatic cancer [PATH:mcc05212]
Human Diseases; Cancers; Glioma [PATH:mcc05214]
Human Diseases; Cancers; Thyroid cancer [PATH:mcc05216]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:mcc05220]
Human Diseases; Cancers; Basal cell carcinoma [PATH:mcc05217]
Human Diseases; Cancers; Melanoma [PATH:mcc05218]
Human Diseases; Cancers; Bladder cancer [PATH:mcc05219]
Human Diseases; Cancers; Prostate cancer [PATH:mcc05215]
Human Diseases; Cancers; Endometrial cancer [PATH:mcc05213]
Human Diseases; Cancers; Small cell lung cancer [PATH:mcc05222]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:mcc05223]
Human Diseases; Neurodegenerative diseases; Amyotrophic lateral sclerosis (ALS) [PATH:mcc05014]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:mcc05016]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:mcc05166]
Human Diseases; Infectious diseases; Measles [PATH:mcc05162]
Human Diseases; Infectious diseases; Hepatitis B [PATH:mcc05161]
Human Diseases; Infectious diseases; Hepatitis C [PATH:mcc05160]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:mcc05168]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:mcc05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16
AA seq 393 aa AA seqDB search
MEEPQSDPSIEPPLSQETFSDLWKLLPENNVLSPLPSQAVDDLMLSPDDLAQWLTEDPGP
DEAPRMSEAAPPMAPTPAAPTPAAPAPAPSWPLSSSVPSQKTYHGSYGFRLGFLHSGTAK
SVTCTYSPDLNKMFCQLAKTCPVQLWVDSTPPPGSRVRAMAIYKQSQHMTEVVRRCPHHE
RCSDSDGLAPPQHLIRVEGNLRVEYSDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS
SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGEPCHQLP
PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPA
GSRAHSSHLKSKKGQSTSRHKKFMFKTEGPDSD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaggagccgcagtcagatcctagcatcgagccccctctgagtcaggaaacattttca
gacctatggaaactacttcctgaaaacaacgttctgtcccccttgccgtcccaagcagtg
gatgatttgatgctgtctccagacgatcttgcacaatggttaactgaagacccaggtcca
gatgaagctccgagaatgtcagaggctgctccccccatggcccccacaccagcagctcct
acaccggcggcccctgcaccagccccctcctggcccctgtcatcctctgtcccttcccag
aaaacctaccatggcagctacggtttccgtctgggcttcctgcattctggaacagccaag
tctgtgacttgcacgtactcccctgacctcaacaagatgttttgccagctggccaagacc
tgccccgtgcagctatgggttgattccacacccccacccggcagccgcgtccgcgccatg
gccatctacaagcagtcacagcacatgacggaggtcgtgaggcgctgcccccaccatgag
cgctgctcagacagcgatggactggcccctcctcagcaccttatccgagtggaaggaaat
ttgcgtgtggagtattcggatgacagaaacacttttcgacatagtgtggtggtgccctat
gagccgcctgaggttggctctgactgtaccaccatccactacaactacatgtgtaacagt
tcctgcatgggcggcatgaaccggaggcccatccttaccattatcacactggaagactcc
agtggtaatctactgggacggaacagctttgaggtgcgagtttgtgcctgtcctgggaga
gaccggcgcacagaggaagagaatttccgcaagaaaggggagccttgccaccagctgccc
cctgggagcactaagcgagcactgcccaacaacaccagctcctctccccagccaaagaag
aaaccactggatggagaatatttcacccttcagatccgtgggcgtgagcgcttcgagatg
ttccgagagctgaatgaggccttggaactcaaggatgcccaggctgggaaagagccagcg
gggagcagggctcactccagccacctgaagtccaagaaggggcaatctacctcccgccat
aaaaaattcatgttcaagacagaggggcctgactcagactga

DBGET integrated database retrieval system