KEGG   Macaca mulatta (rhesus monkey): 716170Help
Entry
716170            CDS       T01028                                 

Gene name
TP53
Definition
tumor protein p53
Orthology
K04451  
tumor protein p53
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Wnt signaling pathway
Neurotrophin signaling pathway
Thyroid hormone signaling pathway
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Hepatitis C
Hepatitis B
Measles
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Proteoglycans in cancer
MicroRNAs in cancer
Colorectal cancer
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Thyroid cancer
Basal cell carcinoma
Melanoma
Bladder cancer
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    716170 (TP53)
   04310 Wnt signaling pathway
    716170 (TP53)
   04151 PI3K-Akt signaling pathway
    716170 (TP53)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    716170 (TP53)
   04210 Apoptosis
    716170 (TP53)
   04115 p53 signaling pathway
    716170 (TP53)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    716170 (TP53)
  Nervous system
   04722 Neurotrophin signaling pathway
    716170 (TP53)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    716170 (TP53)
   05202 Transcriptional misregulation in cancers
    716170 (TP53)
   05206 MicroRNAs in cancer
    716170 (TP53)
   05205 Proteoglycans in cancer
    716170 (TP53)
   05203 Viral carcinogenesis
    716170 (TP53)
   05210 Colorectal cancer
    716170 (TP53)
   05212 Pancreatic cancer
    716170 (TP53)
   05214 Glioma
    716170 (TP53)
   05216 Thyroid cancer
    716170 (TP53)
   05220 Chronic myeloid leukemia
    716170 (TP53)
   05217 Basal cell carcinoma
    716170 (TP53)
   05218 Melanoma
    716170 (TP53)
   05219 Bladder cancer
    716170 (TP53)
   05215 Prostate cancer
    716170 (TP53)
   05213 Endometrial cancer
    716170 (TP53)
   05222 Small cell lung cancer
    716170 (TP53)
   05223 Non-small cell lung cancer
    716170 (TP53)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    716170 (TP53)
   05016 Huntington's disease
    716170 (TP53)
  Infectious diseases
   05166 HTLV-I infection
    716170 (TP53)
   05162 Measles
    716170 (TP53)
   05161 Hepatitis B
    716170 (TP53)
   05160 Hepatitis C
    716170 (TP53)
   05168 Herpes simplex infection
    716170 (TP53)
   05169 Epstein-Barr virus infection
    716170 (TP53)
Transcription factors [BR:mcc03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   p53
    716170 (TP53)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
16
AA seq 393 aa AA seqDB search
MEEPQSDPSIEPPLSQETFSDLWKLLPENNVLSPLPSQAVDDLMLSPDDLAQWLTEDPGP
DEAPRMSEAAPPMAPTPAAPTPAAPAPAPSWPLSSSVPSQKTYHGSYGFRLGFLHSGTAK
SVTCTYSPDLNKMFCQLAKTCPVQLWVDSTPPPGSRVRAMAIYKQSQHMTEVVRRCPHHE
RCSDSDGLAPPQHLIRVEGNLRVEYSDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS
SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGEPCHQLP
PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPA
GSRAHSSHLKSKKGQSTSRHKKFMFKTEGPDSD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaggagccgcagtcagatcctagcatcgagccccctctgagtcaggaaacattttca
gacctatggaaactacttcctgaaaacaacgttctgtcccccttgccgtcccaagcagtg
gatgatttgatgctgtctccagacgatcttgcacaatggttaactgaagacccaggtcca
gatgaagctccgagaatgtcagaggctgctccccccatggcccccacaccagcagctcct
acaccggcggcccctgcaccagccccctcctggcccctgtcatcctctgtcccttcccag
aaaacctaccatggcagctacggtttccgtctgggcttcctgcattctggaacagccaag
tctgtgacttgcacgtactcccctgacctcaacaagatgttttgccagctggccaagacc
tgccccgtgcagctatgggttgattccacacccccacccggcagccgcgtccgcgccatg
gccatctacaagcagtcacagcacatgacggaggtcgtgaggcgctgcccccaccatgag
cgctgctcagacagcgatggactggcccctcctcagcaccttatccgagtggaaggaaat
ttgcgtgtggagtattcggatgacagaaacacttttcgacatagtgtggtggtgccctat
gagccgcctgaggttggctctgactgtaccaccatccactacaactacatgtgtaacagt
tcctgcatgggcggcatgaaccggaggcccatccttaccattatcacactggaagactcc
agtggtaatctactgggacggaacagctttgaggtgcgagtttgtgcctgtcctgggaga
gaccggcgcacagaggaagagaatttccgcaagaaaggggagccttgccaccagctgccc
cctgggagcactaagcgagcactgcccaacaacaccagctcctctccccagccaaagaag
aaaccactggatggagaatatttcacccttcagatccgtgggcgtgagcgcttcgagatg
ttccgagagctgaatgaggccttggaactcaaggatgcccaggctgggaaagagccagcg
gggagcagggctcactccagccacctgaagtccaagaaggggcaatctacctcccgccat
aaaaaattcatgttcaagacagaggggcctgactcagactga

DBGET integrated database retrieval system