KEGG   Macaca mulatta (rhesus monkey): 716176Help
Entry
716176            CDS       T01028                                 

Gene name
POM121
Definition
POM121 transmembrane nucleoporin
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
RNA transport
Module
Nuclear pore complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:mcc03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 1225 aa AA seqDB search
MSPAAAAAGAGERRRSIASVRDGRGRGRGGQAGAALLGLSLVGLLLYLVPAAAALAWLAV
GATAAWWGLSREPRGSRPLSSFVRNARHRRTLFASPPAKSTANGNLLEPRTLLEGPDPAE
LLLMGSYLGKPGPPQPASAPEGQDLRDRPGRRPLARPAPRSPQPHRVHHVYPSLPTPLLR
PSGRPSPRDCGTLPNRFVITPRRRYPIHQAQYSCLGVLPTVCWNGYHKKAVLSPRNSRMV
CSPVTVRIAPPDRRFSRSAIPEQIISSTLSSPSSNAPDPCAKETVLSALKEKKKKRTVEE
EDQIFLDGQENKRRRHDSSGSGHSAFEPLVANGVPASFVPKPGSLKRGLNSQSSDDHLNK
RSRSSSMSSLTSAYTSGIPSSSRNAITSSYSSTRGISQLWKRSGPSSSPFSSPASSRSQT
PERPAKKIREEELCHHSSSSTPLVADKESQGEKVADTTLRKKQNSNSQSTPGNSGQRKRK
IQLLPSRRGEQLTLPPPPQLGYSITAEDLDLEKKASLQWFNKALEDKSDAASNSVTETPP
TTQPSFTFTLPAAATASPPTSLPGPSTNPLLESLKKMQSPPNLPPCPESAGAATTEAPSP
PKTPSLLPALGLPQSGLPGPLPSPSLDSKPPTTLLGLIPAPSTVPATDTKSPPTLQGETA
AKPQATSAPSPAPKQSFLFGTQSTSPSSPPAPAASSASPMFKPIFMAPPKSEKEGPTPPG
PSVTATAPSSSSLPTTTSTTAPTFQPVFSSMGPPASLPLSAPFFKQTTIPTTAPTTTAPL
FTGLATATSAVAPVTTASPSADSAVKPAFGFGVNSVSSSSVSTTTSTATATSQPFLFGAP
QASAASFTPAMGSIFQFGKPPALPTTTTVTTFSQSLPTAVPTATSSSASGFSAFGSTLTT
SAPATSSQPTLTFSNTSTPTFNIPFGSSAKSPLPSYPGANPQPAFGAAEGQPPGPAKPAL
APSFGSSFTFGNSAAPAPAAAPTPAPASTIKIVPAHVPTPIHPTFGGATHSAFGLKATTS
AFGTPASSQPAFGSSTAVFSFGAATSSGFGATTQTASSGSSSSVFGSTTPSPFTFGGSAA
PAGSGSFGINVATPGSSTTSGAFSFGAGQSGTTATSTPFAGGLGQNALGTTSQSTPFAFN
VGSTPESKPVFGGTATPTFGQNTPAPGVGTSGSSLSFGASSTPAQGFVGIGPFGSAAPSF
SIGAGSKTPGARQRLQARRQHNRKK
NT seq 3678 nt NT seq  +upstreamnt  +downstreamnt
atgtctccggcggctgcggcggctggagcaggcgagcggcggcggtccatagcgagtgtc
agggacggccggggccggggccgcggcgggcaagccggggccgcgctcctcggcctgtcg
ctggtcggcctcctactgtacctcgtgccggctgcggctgcgctggcctggctggccgtg
ggggctaccgcggcctggtggggactgagccgcgagccccgaggttcgcgccccttgtcc
tccttcgttcggaacgcgcgacatcggcgaacactgttcgcttcgcctccggccaagtcg
acagccaacggaaacctcctagagccgcggaccctgctcgaaggacctgaccctgccgaa
ctgctactcatgggcagttacctgggcaagcccgggccgccgcagcccgcctccgctccg
gagggccaggacctgcgggataggcctggccgccgcccactcgcccgcccggcgccgcgc
tccccgcagccgcatcgcgttcaccacgtttacccctctctccccactcctcttctccga
ccctccgggaggccttccccacgggattgtgggactttaccaaatcggtttgtaataaca
cctcgaagacgctatccgatccatcaggcccaatattcctgtctgggggtacttcccaca
gtgtgttggaatggttatcacaagaaggctgtgctgtcccctcgcaactccaggatggtg
tgtagcccagttactgtgagaatcgcccctcccgacagaagattttcgcgttctgcgata
ccagagcagataatcagctcaacactgtcctcaccatcaagtaatgccccagacccatgt
gcaaaggagactgtactgagtgccctcaaagagaagaagaagaaaaggacagtggaggaa
gaagaccaaatattccttgatggccaggaaaataaaagaaggcgccatgatagcagtggc
agtggacattcagcatttgagcccctggtggccaatggagtccccgcttcttttgtgcct
aagcctgggtctctgaagagaggcctcaattctcagagctcagatgaccacttgaataag
agatcccgaagctcttctatgagctccttgacaagcgcttacacaagtggcatccctagc
tccagccgcaatgccattaccagttcctacagctccactcgaggcatctcacagctctgg
aagagaagtggccccagttcatcacccttctctagcccagcctcatcccgctcccagaca
ccagagaggccagcaaagaaaataagagaagaggagctatgtcatcattccagttcctca
actccattggtggcggacaaggagtcccagggagaaaaggttgcagatacaaccctaagg
aagaaacaaaactcgaattctcagtctacacctggcaactctgggcagcgtaagcggaaa
attcagctgctgccttctcggcgaggggaacagctgaccttgcctccacctccccagctt
ggctattcgatcactgccgaggacctagacttagagaagaaggcttcattacagtggttc
aacaaggccttggaggacaagagcgacgctgcctcgaactctgtcactgagaccccacct
accactcagccttcgtttacctttaccctgcctgctgctgcaactgcctccccacccacc
tccctcccaggcccaagcaccaacccactgttagagagcttgaagaagatgcagagtccc
ccgaacctgccaccctgcccagaatctgctggagcagcaaccactgaggccccctcgcct
ccaaagacgcccagcctcctgcccgctctgggcttaccacagtcagggctgccagggccc
ctccccagcccctccttagactccaaacccccgaccactttgctggggctgatccctgct
ccatccacagtaccagccactgacaccaagtcacctccaacccttcagggagagacggct
gccaaaccccaagccacatctgccccgtcccccgcccccaagcaaagcttcctgtttgga
acacagagcacctcaccttccagccctcccgcccctgccgcgtcttcagcatctcccatg
ttcaagcccattttcatggccccacccaagagtgagaaggaaggccccacaccgcctggc
ccttcagtcacagccacagcgccctccagctcctccctccccacaaccaccagcaccaca
gccccaaccttccagcctgtctttagcagcatggggccacctgcatctttgcccttgtct
gctcccttcttcaagcagacaactattcccaccactgctcccaccacaactgccccgctc
ttcactggcctggccaccgccacctctgctgtggctcccgtcaccaccgccagtccatcc
gcagactctgctgtgaagcctgcatttggctttggcgtaaacagtgtgagcagcagcagt
gtgagcaccacgaccagcaccgccactgccacctcacagcctttcctcttcggggcgccc
caggcctctgctgccagcttcaccccggccatgggctccatattccagtttggcaaacct
cctgccctgcccacaaccaccacagtcaccacctttagccagtccctgcccactgccgtg
ccaacggccaccagcagcagcgcttccggctttagtgctttcggcagcacccttaccact
tccgccccggccaccagcagccagcccactctgacgttcagtaacacgagcacccccaca
ttcaacattccctttggctcaagcgccaagtccccactcccatcatatccaggagccaac
ccccagcctgcatttggggccgctgaggggcagccgccggggcccgccaagccggccctt
gcccccagctttggcagctctttcacttttggaaactccgcagccccagccccagctgct
gcacccacacctgcacctgcgtccacgatcaagatcgtgcctgcgcacgtgcctacaccc
atccatcctacctttggtggtgccacgcactcagcatttgggttgaaagccacgacttcg
gccttcggcactcccgccagctcacagcccgcttttggcagctccactgctgtcttctct
ttcggtgcagccaccagctctggctttggagccaccacgcagaccgccagcagcgggagc
agcagctcggtgttcggcagcacaacaccatcacccttcacatttgggggttcggcggcc
cctgctggcagtgggagctttgggatcaacgtggccaccccaggctccagcaccacctct
ggggcttttagcttcggagcgggacagagtgggaccacagccacctccacccccttcgca
gggggcttaggtcagaacgccctgggcaccaccagccagagtacaccgtttgccttcaac
gtgggcagcacgcctgagagcaaacctgtgtttggaggcaccgccactcccacctttggt
cagaacacccctgcgcctggagtgggcacatcaggcagcagcctctcctttggggcatcc
tcaacacctgcccaaggctttgttggcattggaccgtttggatcggcggccccttcattt
tccattggtgcgggatccaagaccccaggggctcgacagcgactgcaggcccgaaggcag
cacaaccgcaaaaaatag

DBGET integrated database retrieval system