KEGG   Macaca mulatta (rhesus monkey): 716176Help
Entry
716176            CDS       T01028                                 

Gene name
POM121C, POM121
Definition
(RefSeq) POM121 transmembrane nucleoporin C
  KO
K14316  
nuclear pore complex protein Nup121
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    716176 (POM121C)
Messenger RNA biogenesis [BR:mcc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     716176 (POM121C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 1225 aa AA seqDB search
MSPAAAAAGAGERRRSIASVRDGRGRGRGGQAGAALLGLSLVGLLLYLVPAAAALAWLAV
GATAAWWGLSREPRGSRPLSSFVRNARHRRTLFASPPAKSTANGNLLEPRTLLEGPDPAE
LLLMGSYLGKPGPPQPASAPEGQDLRDRPGRRPLARPAPRSPQPHRVHHVYPSLPTPLLR
PSGRPSPRDCGTLPNRFVITPRRRYPIHQAQYSCLGVLPTVCWNGYHKKAVLSPRNSRMV
CSPVTVRIAPPDRRFSRSAIPEQIISSTLSSPSSNAPDPCAKETVLSALKEKKKKRTVEE
EDQIFLDGQENKRRRHDSSGSGHSAFEPLVANGVPASFVPKPGSLKRGLNSQSSDDHLNK
RSRSSSMSSLTSAYTSGIPSSSRNAITSSYSSTRGISQLWKRSGPSSSPFSSPASSRSQT
PERPAKKIREEELCHHSSSSTPLVADKESQGEKVADTTLRKKQNSNSQSTPGNSGQRKRK
IQLLPSRRGEQLTLPPPPQLGYSITAEDLDLEKKASLQWFNKALEDKSDAASNSVTETPP
TTQPSFTFTLPAAATASPPTSLPGPSTNPLLESLKKMQSPPNLPPCPESAGAATTEAPSP
PKTPSLLPALGLPQSGLPGPLPSPSLDSKPPTTLLGLIPAPSTVPATDTKSPPTLQGETA
AKPQATSAPSPAPKQSFLFGTQSTSPSSPPAPAASSASPMFKPIFMAPPKSEKEGPTPPG
PSVTATAPSSSSLPTTTSTTAPTFQPVFSSMGPPASLPLSAPFFKQTTIPTTAPTTTAPL
FTGLATATSAVAPVTTASPSADSAVKPAFGFGVNSVSSSSVSTTTSTATATSQPFLFGAP
QASAASFTPAMGSIFQFGKPPALPTTTTVTTFSQSLPTAVPTATSSSASGFSAFGSTLTT
SAPATSSQPTLTFSNTSTPTFNIPFGSSAKSPLPSYPGANPQPAFGAAEGQPPGPAKPAL
APSFGSSFTFGNSAAPAPAAAPTPAPASTIKIVPAHVPTPIHPTFGGATHSAFGLKATTS
AFGTPASSQPAFGSSTAVFSFGAATSSGFGATTQTASSGSSSSVFGSTTPSPFTFGGSAA
PAGSGSFGINVATPGSSTTSGAFSFGAGQSGTTATSTPFAGGLGQNALGTTSQSTPFAFN
VGSTPESKPVFGGTATPTFGQNTPAPGVGTSGSSLSFGASSTPAQGFVGIGPFGSAAPSF
SIGAGSKTPGARQRLQARRQHNRKK
NT seq 3678 nt NT seq  +upstreamnt  +downstreamnt
atgtctccggcggctgcggcggctggagcaggcgagcggcggcggtccatagcgagtgtc
agggacggccggggccggggccgcggcgggcaagccggggccgcgctcctcggcctgtcg
ctggtcggcctcctactgtacctcgtgccggctgcggctgcgctggcctggctggccgtg
ggggctaccgcggcctggtggggactgagccgcgagccccgaggttcgcgccccttgtcc
tccttcgttcggaacgcgcgacatcggcgaacactgttcgcttcgcctccggccaagtcg
acagccaacggaaacctcctagagccgcggaccctgctcgaaggacctgaccctgccgaa
ctgctactcatgggcagttacctgggcaagcccgggccgccgcagcccgcctccgctccg
gagggccaggacctgcgggataggcctggccgccgcccactcgcccgcccggcgccgcgc
tccccgcagccgcatcgcgttcaccacgtttacccctctctccccactcctcttctccga
ccctccgggaggccttccccacgggattgtgggactttaccaaatcggtttgtaataaca
cctcgaagacgctatccgatccatcaggcccaatattcctgtctgggggtacttcccaca
gtgtgttggaatggttatcacaagaaggctgtgctgtcccctcgcaactccaggatggtg
tgtagcccagttactgtgagaatcgcccctcccgacagaagattttcgcgttctgcgata
ccagagcagataatcagctcaacactgtcctcaccatcaagtaatgccccagacccatgt
gcaaaggagactgtactgagtgccctcaaagagaagaagaagaaaaggacagtggaggaa
gaagaccaaatattccttgatggccaggaaaataaaagaaggcgccatgatagcagtggc
agtggacattcagcatttgagcccctggtggccaatggagtccccgcttcttttgtgcct
aagcctgggtctctgaagagaggcctcaattctcagagctcagatgaccacttgaataag
agatcccgaagctcttctatgagctccttgacaagcgcttacacaagtggcatccctagc
tccagccgcaatgccattaccagttcctacagctccactcgaggcatctcacagctctgg
aagagaagtggccccagttcatcacccttctctagcccagcctcatcccgctcccagaca
ccagagaggccagcaaagaaaataagagaagaggagctatgtcatcattccagttcctca
actccattggtggcggacaaggagtcccagggagaaaaggttgcagatacaaccctaagg
aagaaacaaaactcgaattctcagtctacacctggcaactctgggcagcgtaagcggaaa
attcagctgctgccttctcggcgaggggaacagctgaccttgcctccacctccccagctt
ggctattcgatcactgccgaggacctagacttagagaagaaggcttcattacagtggttc
aacaaggccttggaggacaagagcgacgctgcctcgaactctgtcactgagaccccacct
accactcagccttcgtttacctttaccctgcctgctgctgcaactgcctccccacccacc
tccctcccaggcccaagcaccaacccactgttagagagcttgaagaagatgcagagtccc
ccgaacctgccaccctgcccagaatctgctggagcagcaaccactgaggccccctcgcct
ccaaagacgcccagcctcctgcccgctctgggcttaccacagtcagggctgccagggccc
ctccccagcccctccttagactccaaacccccgaccactttgctggggctgatccctgct
ccatccacagtaccagccactgacaccaagtcacctccaacccttcagggagagacggct
gccaaaccccaagccacatctgccccgtcccccgcccccaagcaaagcttcctgtttgga
acacagagcacctcaccttccagccctcccgcccctgccgcgtcttcagcatctcccatg
ttcaagcccattttcatggccccacccaagagtgagaaggaaggccccacaccgcctggc
ccttcagtcacagccacagcgccctccagctcctccctccccacaaccaccagcaccaca
gccccaaccttccagcctgtctttagcagcatggggccacctgcatctttgcccttgtct
gctcccttcttcaagcagacaactattcccaccactgctcccaccacaactgccccgctc
ttcactggcctggccaccgccacctctgctgtggctcccgtcaccaccgccagtccatcc
gcagactctgctgtgaagcctgcatttggctttggcgtaaacagtgtgagcagcagcagt
gtgagcaccacgaccagcaccgccactgccacctcacagcctttcctcttcggggcgccc
caggcctctgctgccagcttcaccccggccatgggctccatattccagtttggcaaacct
cctgccctgcccacaaccaccacagtcaccacctttagccagtccctgcccactgccgtg
ccaacggccaccagcagcagcgcttccggctttagtgctttcggcagcacccttaccact
tccgccccggccaccagcagccagcccactctgacgttcagtaacacgagcacccccaca
ttcaacattccctttggctcaagcgccaagtccccactcccatcatatccaggagccaac
ccccagcctgcatttggggccgctgaggggcagccgccggggcccgccaagccggccctt
gcccccagctttggcagctctttcacttttggaaactccgcagccccagccccagctgct
gcacccacacctgcacctgcgtccacgatcaagatcgtgcctgcgcacgtgcctacaccc
atccatcctacctttggtggtgccacgcactcagcatttgggttgaaagccacgacttcg
gccttcggcactcccgccagctcacagcccgcttttggcagctccactgctgtcttctct
ttcggtgcagccaccagctctggctttggagccaccacgcagaccgccagcagcgggagc
agcagctcggtgttcggcagcacaacaccatcacccttcacatttgggggttcggcggcc
cctgctggcagtgggagctttgggatcaacgtggccaccccaggctccagcaccacctct
ggggcttttagcttcggagcgggacagagtgggaccacagccacctccacccccttcgca
gggggcttaggtcagaacgccctgggcaccaccagccagagtacaccgtttgccttcaac
gtgggcagcacgcctgagagcaaacctgtgtttggaggcaccgccactcccacctttggt
cagaacacccctgcgcctggagtgggcacatcaggcagcagcctctcctttggggcatcc
tcaacacctgcccaaggctttgttggcattggaccgtttggatcggcggccccttcattt
tccattggtgcgggatccaagaccccaggggctcgacagcgactgcaggcccgaaggcag
cacaaccgcaaaaaatag

DBGET integrated database retrieval system