KEGG   Macaca mulatta (rhesus monkey): 716505Help
Entry
716505            CDS       T01028                                 

Gene name
USP20
Definition
ubiquitin specific peptidase 20
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 914 aa AA seqDB search
MGDARDLCPHLDSIGEVTKEDLLLKSKGTCQSCGVTGPNLWACLQVSCPYVGCGESFADH
STIHAQAKKHNLTVNLTTFRLWCYACEKEVFLEQRLAAPLPGSSSKFSEQDSLPPSHPLK
AVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLV
RTDKKPALCKSYQKLVSEVWHKKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLM
DQLHEELKEPVVATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGR
GGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNSEQVDEDADVDTTMAALDDQ
PVEAQPPSPRSASPCRTPEPDNDAHLRSSSRPCSPVHHHEGHAKLSSSPPRASPVRMAPS
YVLKKAQVLSAGSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIP
GKEDLARLHSAIYQNVPAKPGACGDSYAAQGWLAFIVEYIRRFVVSCTPSWFWGPVVTLE
DCLAAFFAADELKGDNMYSCERCKKLRNGVKYCRVLRLPEILCIHLKRFRHEVMYSFKIN
SHVSFPLEGLDLRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEFD
DQYVTEVHETVVQNAEGYVLFYRKSSEEAVRERQQVVSLAAMREPSLLRFYVSREWLNKF
NTFAEPGPITNQTFLCSHGGIPPHKYHYIDDLVVILPQNVWEHLYNRFGGGPAVNHLYVC
SICQVEIEALAKRRRIEIDTFIKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEPP
GPIDNSRIAQVKGSGHVQLKQGADYGQISEETWNYLNSLYGGGPEIAIRQSVVQPPGPES
LHGEQKIEAETRAV
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgggggacgccagggacctttgccctcaccttgactccataggggaggtaaccaaagag
gacttgctgctcaaatctaagggaacctgtcagtcatgtggagtcaccggaccaaacctt
tgggcctgtctccaggtctcctgcccctatgttggctgtggagaatccttcgctgaccac
agcaccattcatgcacaggcaaaaaagcacaacttgaccgtgaacctgaccacattccgg
ctgtggtgttacgcctgtgagaaggaggtgttcctggagcagcggctggcagcccctctg
ccgggctcctcctccaagttctctgaacaggactccctgccaccctcccaccctctgaaa
gctgttcctattgctgtggctgatgaaggagagtctgagtcagaggacgatgacctgaaa
cctcgaggcctcacgggcatgaagaacctcgggaactcctgctatatgaacgctgccctg
caggccctgtccaattgcccaccgctgactcagttcttcctggagtgtggaggcctggtg
cgcacagacaaaaagccagccctgtgcaagagctaccagaagctggtctctgaggtctgg
cacaagaaacggccaagctacgtggtccccaccagtctgtctcatgggatcaagttggtc
aacccaatgttccgaggctatgcccagcaggacacccaagagttccttcgctgcttgatg
gaccagctacacgaggagctcaaggagccagtggtggccacggtggcgctgacagaggct
cgggactcagactcgagtgacacagatgagaaacgggagggtgaccggagcccatcagaa
gatgagttcttgtcctgcgactcgagcagtgaccggggtgagggtgacgggcaggggcgt
ggcgggggcagctcgcaggccgagacggagctgctgatcccagatgaggcaggcagagcc
atctctgagaaggagcggatgaaggaccgcaagttctcctggggccagcagcgcacaaac
tcggagcaagtggacgaggatgctgatgtggacaccaccatggctgcccttgacgaccag
cctgtggaggcccagcccccatcaccacggtccgccagcccctgccggacgccagagccg
gacaacgatgcccacctacgcagctcctctcgcccctgcagccccgtccaccaccatgag
ggccatgcgaagctgtctagcagtccccctcgtgcaagccccgtgaggatggcaccgtcg
tatgtgctcaagaaagcccaggtattgagtgccggcagccggaggcggaaggagcagcgc
taccgcagcgtcatctcagacatctttgacggctctatcctcagcctcgtgcagtgtctc
acctgtgaccgggtgtccaccacagtggagacgttccaggacctatcgctgcccattcct
ggcaaggaggacctggccaggctccactcagccatctaccagaatgtgccggccaagcca
ggcgcctgtggggacagctatgccgcccagggctggctggccttcattgtggagtacatc
cgacggtttgtggtatcctgtacccccagctggttttgggggcctgtcgtcaccctggaa
gactgccttgctgccttctttgccgctgatgagctgaagggtgacaacatgtacagctgt
gagcggtgtaagaagctgcggaacggagtgaagtactgcagagtcctgcggttgcccgag
atcctgtgcattcacctgaagcgctttcggcacgaggtgatgtactcattcaagatcaac
agccacgtctccttccccctcgaggggctcgacctgcgcccctttcttgccaaggagtgc
acatcccagatcaccacctacgacctcctctcggtcatctgccatcacggcacggcaggc
agtgggcactacatcgcctactgccagaatgtgatcaatgggcagtggtacgaattcgac
gaccagtacgtcacagaagtccatgagacagtggtgcagaacgccgagggctacgtcctc
ttctacaggaagagcagcgaggaggccgtgcgggagcggcagcaggtggtgtccctggcc
gctatgcgggagcccagcctgctgcggttctacgtgtcccgcgagtggctcaacaagttc
aacaccttcgcagagccaggacccatcaccaaccagaccttcctctgctcccacggaggc
atcccgccccacaaataccactacatcgacgacctggtggttatcctgccccagaacgtc
tgggagcacctgtacaacagattcgggggtggccccgccgtcaaccacctgtacgtgtgc
tccatctgccaggtggagatcgaggcgttggccaagcgcaggaggatcgagatcgacacc
ttcatcaagctgaacaaggccttccaggccgaggagtcgccgggcgtcatctactgcatc
agcatgcagtggttccgggagtgggaggcgttcgtcaaggggaaggacaacgagcccccc
gggcccattgacaacagcaggattgcacaggtcaaaggaagcggccacgtccagctgaag
cagggagctgactacgggcagatttcagaggagacctggaactacctgaacagcctgtac
ggaggcggccccgagatcgccatccgccagagcgtggtgcagccgccgggcccggagagc
ctgcacggggagcagaagatcgaagccgagacccgggcagtgtga

DBGET integrated database retrieval system