KEGG   Macaca mulatta (rhesus monkey): 716579Help
Entry
716579            CDS       T01028                                 

Gene name
ACR
Definition
acrosin
Orthology
K01317  
acrosin [EC:3.4.21.10]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.10  acrosin
     716579 (ACR)
Peptidases [BR:mcc01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   716579 (ACR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 399 aa AA seqDB search
MVEMLPTAILLVLAVSVVAKDNATCDGPCGLRFRQNPQGGARIVGGKAAQHGAWPWMVSL
QIFTYGSHRYHACGGSLLNSRWVLTAAHCFVGKNKVYDWRLVFGAKEITYGNNKPVKAPL
QERYVEKIIIHEKYNSATEGNDIALVKITPPISCGRFVGPGCLPHFKAGLPRGPQICWVA
GWGYIEEKAPRPSSMLMEARVDLIDLDLCNSTQWYNGRIQPTNVCAGYPLGKIDTCQGDS
GGPLMCKDSKKGAYVVVGITSWGVGCARAKRPGIYTATWPYLNWIASKIGSNALHMIQPA
TPPSPTTRPPPIQLPSSHPISAHLPWYFQPPPRPLPSRPPSARPRPPPPPPPTTKPPQGL
SFAKRLQQLIEALKGKTYSDGKNYYDMETTELPELTSTS
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggttgagatgctaccaactgccattctgctggtcttggcagtgtccgtggttgctaaa
gataacgccacctgtgatggcccctgtgggttacggttcaggcagaacccacaaggtggt
gcccgcattgtcggcgggaaggctgcacagcatggggcctggccctggatggtcagcctc
cagatcttcacgtacggcagtcacaggtaccacgcatgtggaggcagcttgctgaattcg
cgatgggtgctcacggctgctcactgcttcgttggcaaaaataaagtgtatgactggaga
ctggttttcggagcaaaggaaattacatacgggaacaataaaccagtaaaggcacctctg
caagagagatatgtggagaaaatcatcattcacgaaaaatacaactctgcaacagaggga
aacgacattgcccttgtgaagatcacccctcccatttcgtgtgggcgtttcgttgggccg
ggctgcctgccccactttaaggcaggcctccccagaggcccccagatctgctgggtggct
ggctggggatatatagaagagaaagcccccaggccatcatctatgctgatggaggcgcgt
gtggatctcatcgacctggacttgtgtaactcgacccagtggtacaatgggcgcattcag
ccaaccaatgtgtgcgcggggtatcctttaggcaagatcgacacctgccagggggacagc
ggcgggcctctcatgtgcaaagacagcaagaaaggcgcctacgtggtcgtgggaatcaca
agctggggggtaggctgtgcccgtgccaagcgccccggaatctacacggccacctggccc
tatctgaactggattgcctccaagattggttctaatgctctgcatatgattcaaccggcc
acccctccatcccccaccactagaccgcccccaattcaactcccctcctcccaccctatc
tctgctcaccttccttggtatttccaaccgccccctcgaccacttccatcccgaccacct
tcagctcggcctcgacccccacctccacccccgcccacaacaaaacctccccaaggactt
tcttttgccaagcgcctacagcagctcatagaggccttgaaggggaagacctattccgac
ggaaagaactattatgacatggagaccacagagctcccagagctgacctctacctcctga

DBGET integrated database retrieval system