KEGG   Macaca mulatta (rhesus monkey): 716612Help
Entry
716612            CDS       T01028                                 

Gene name
RPA2
Definition
(RefSeq) replication protein A2
  KO
K10739  replication factor A2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc03030  DNA replication
mcc03420  Nucleotide excision repair
mcc03430  Mismatch repair
mcc03440  Homologous recombination
mcc03460  Fanconi anemia pathway
Module
mcc_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    716612 (RPA2)
   03420 Nucleotide excision repair
    716612 (RPA2)
   03430 Mismatch repair
    716612 (RPA2)
   03440 Homologous recombination
    716612 (RPA2)
   03460 Fanconi anemia pathway
    716612 (RPA2)
DNA replication proteins [BR:mcc03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    716612 (RPA2)
DNA repair and recombination proteins [BR:mcc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     716612 (RPA2)
   MMR (mismatch exicision repair)
     716612 (RPA2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     716612 (RPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C tRNA_anti-codon MarR_2
Motif
Other DBs
NCBI-GeneID: 716612
NCBI-ProteinID: NP_001247563
Ensembl: ENSMMUG00000018172
UniProt: F7EYD7
Position
1
AA seq 270 aa AA seqDB search
MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLV
DEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDASSENTVV
PPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGR
APISNPGMSEAGNFGGNSFLPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVS
SIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtggaacagtggattcgaaagctatggcagctcctcatatgggggagccggcggctac
acgcagtccccggggggctttggatcgcccgcaccttctcaggccgaaaagaaatcaaga
gcccgagcccagcacattgtaccctgtactatatctcagctgctttctgccactttggtt
gatgaagtgttcagaattgggaatgttgagatttcacaggtcactattgtggggatcatc
agacatgcagagaaggctccaaccaacattgtttacaaaatagatgacatgacagctgca
cccatggacgttcgccagtgggttgacacagatgatgccagcagtgaaaacactgtggtt
cctccagaaacatatgtgaaagtggcaggccacctgagatcttttcagaacaaaaagagc
ctggtagcctttaaaatcatgcccctggaggatatgaatgagttcaccacacatattctg
gaagtgatcaatgcacacatggtactaagcaaagccaacagccagccctcagcagggaga
gcacctatcagcaatccaggaatgagtgaagcagggaacttcggtgggaatagcttcctg
ccagcaaatggcctcactgtggcccaaaaccaggtgttgaatttgattaaggcttgtcca
agacctgaagggttgaactttcaggatctcaagaaccagctgaaacacatgtctgtatct
tcaatcaagcaagctgtggattttctgagcaatgaggggcacatctattctactgtggat
gatgaccattttaaatccacagatgcagaataa

DBGET integrated database retrieval system