KEGG   Macaca mulatta (rhesus monkey): 716612Help
Entry
716612            CDS       T01028                                 

Gene name
RPA2
Definition
replication protein A2, 32kDa
Orthology
K10739  
replication factor A2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    716612 (RPA2)
   03420 Nucleotide excision repair
    716612 (RPA2)
   03430 Mismatch repair
    716612 (RPA2)
   03440 Homologous recombination
    716612 (RPA2)
   03460 Fanconi anemia pathway
    716612 (RPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 270 aa AA seqDB search
MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLV
DEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDASSENTVV
PPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGR
APISNPGMSEAGNFGGNSFLPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVS
SIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtggaacagtggattcgaaagctatggcagctcctcatatgggggagccggcggctac
acgcagtccccggggggctttggatcgcccgcaccttctcaggccgaaaagaaatcaaga
gcccgagcccagcacattgtaccctgtactatatctcagctgctttctgccactttggtt
gatgaagtgttcagaattgggaatgttgagatttcacaggtcactattgtggggatcatc
agacatgcagagaaggctccaaccaacattgtttacaaaatagatgacatgacagctgca
cccatggacgttcgccagtgggttgacacagatgatgccagcagtgaaaacactgtggtt
cctccagaaacatatgtgaaagtggcaggccacctgagatcttttcagaacaaaaagagc
ctggtagcctttaaaatcatgcccctggaggatatgaatgagttcaccacacatattctg
gaagtgatcaatgcacacatggtactaagcaaagccaacagccagccctcagcagggaga
gcacctatcagcaatccaggaatgagtgaagcagggaacttcggtgggaatagcttcctg
ccagcaaatggcctcactgtggcccaaaaccaggtgttgaatttgattaaggcttgtcca
agacctgaagggttgaactttcaggatctcaagaaccagctgaaacacatgtctgtatct
tcaatcaagcaagctgtggattttctgagcaatgaggggcacatctattctactgtggat
gatgaccattttaaatccacagatgcagaataa

DBGET integrated database retrieval system