KEGG   Macaca mulatta (rhesus monkey): 716618Help
Entry
716618            CDS       T01028                                 

Gene name
CAPN1
Definition
calpain 1, (mu/I) large subunit
Orthology
K01367  
calpain-1 [EC:3.4.22.52]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Alzheimer's disease
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:mcc04141]
Cellular Processes; Cell growth and death; Apoptosis [PATH:mcc04210]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:mcc05010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 714 aa AA seqDB search
MAEEIITPVYCTGVSAQVQKQRAKELGLGRHENAIKYLGQDYEQLRARCLQSGTLFRDEA
FPPVPQSLGFKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHS
AEGNEFWSALLEKAYAKVNGSYESLSGGSTSEGFEDFTGGVTEWYELRKAPSDLYQIILK
ALERGSLLGCSIDISSVLDMEAITFKKLVKGHAYSVTGAKQVNYRGQMVNLIRMRNPWGE
VEWTGAWSDSSSEWNSVDPYEREQLRVKMEDGEFWMSFRDFMREFTRLEICNLTPDALKS
RTIRKWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLDETDDPDDYGDRESGCSFV
LALMQKHRRRERRFGRDMETIGFAVYEVPPELVGQPALHLKRDFFLANASRARSEQFINL
REVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKSAGTAELDDQIQANLPDEQVLSE
EEIDENFKALFRQLAGEDMEISVKELRTILNRIISKHKDLRTKGFSLESCRSMVNLMDRD
GNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLYELII
TRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggagatcatcacaccggtgtactgcaccggggtgtcagcccaagtgcagaag
cagcgggccaaggagctgggcctgggccgccatgagaatgccatcaagtacctgggccag
gattatgagcagctgcgggcgcgatgcctgcagagtgggaccctcttccgtgatgaggcc
ttccccccagtgccccagagcctgggtttcaaggacctgggtcccaattcctccaagacc
tatggcatcaagtggaagcgtcccacggagctgctttcaaacccccagttcatcgtggat
ggagccacccgcacagacatctgccagggagcactgggggactgctggctcctggcggcc
attgcctcacttactcttaacgacaccctcctgcaccgagtggttccacacggccagagc
ttccagaatggctatgccggcatcttccacttccagctgtggcaatttggggaatgggtg
gacgtggtcgtggatgacctgctgcccatcaaggacgggaagctagtgttcgtgcactct
gccgaaggcaatgagttctggagcgccctgcttgagaaggcctatgccaaggtaaatggc
agctacgagtccctgtcagggggcagcacctcagagggctttgaggacttcacaggcggg
gtcaccgagtggtacgagttgcgaaaggctccgagtgacctctaccagatcatcctcaag
gcgctggagcggggctccctgctgggctgctccatagacatctccagcgttctagacatg
gaggccatcaccttcaagaagctggtgaagggccacgcctactctgtgaccggggccaag
caggtgaactaccgaggccagatggtgaacctgatccggatgcggaacccctggggcgag
gtagagtggacgggagcctggagcgacagctcctcagagtggaacagcgtggacccatat
gaacgggagcagctccgggtcaagatggaggatggggagttctggatgtcattccgagac
ttcatgcgggagttcacccgcctggagatctgcaacctcacgcccgacgcccttaagagc
cggaccatccgcaaatggaacaccacactctatgaaggcacctggcggcgggggagcacc
gcggggggctgccggaactacccagccaccttctgggtgaacccccagttcaagatccgg
ctggatgagacggatgacccggacgactacggggaccgcgagtcaggctgcagcttcgtg
ctcgcccttatgcagaagcaccgccgccgcgagcgccgcttcggccgcgacatggagact
attggctttgcagtctacgaggtccctccggagctggtgggccagccggccctacacttg
aagcgtgatttcttcctggccaatgcgtctcgggcgcgctcagagcagttcatcaacctg
cgagaggtcagcacccgcttccgcctgccacctggggagtatgtggtggtgccctccacc
ttcgaacccaacaaggagggcgacttcgtgctgcgcttcttctcggagaagagtgctggg
acagccgagctggatgaccagatccaggccaatctccccgacgagcaagtgctctcagaa
gaggagattgatgagaacttcaaggccctcttcaggcagctggcaggggaggacatggag
atcagcgtgaaggagctgcggacaatcctcaacaggatcatcagcaaacacaaagacctg
cggaccaagggcttcagcctagagtcgtgccgcagcatggtgaacctcatggatcgtgac
ggcaatgggaagctgggcctggtggagttcaacatcctgtggaaccgcatccggaattac
ctgtccatcttccggaagtttgacctggacaagtcgggcagcatgagtgcctatgagatg
cggatggccatcgagtcggcaggcttcaagctcaacaaaaagctttatgagctcatcatc
acccgctactcagagcccgacctggcggtcgactttgacaatttcgtgtgctgcctggtg
cggctagagaccatgttccgatttttcaagactctggacacagatctggatggagtcgtg
acgtttgacttgtttaagtggttgcagctgaccatgtttgcatga

DBGET integrated database retrieval system