KEGG   Macaca mulatta (rhesus monkey): 716793Help
Entry
716793            CDS       T01028                                 

Gene name
USP15
Definition
ubiquitin specific peptidase 15 (EC:3.4.19.12)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     716793 (USP15)
Peptidases [BR:mcc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   716793 (USP15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
11
AA seq 952 aa AA seqDB search
MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNV
YPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQ
GMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLW
NKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSTPNVKNSNYCLPSYT
AYKNYDYSEPGRNNEQPGLCGLSNLGNTCFMNSAIQCLSNTPPLTEYFLNDKYQEELNFD
NPLGMRGEIAKSYAELIKQMWSGKFSYVTPRAFKTQVGRFAPQFSGYQQQDCQELLAFLL
DGLHEDLNRIRKKPYIQLKDADGRPDKVVAEEAWENHLKRNDSIIVDIFHGLFKSTLVCP
ECAKISVTFDPFCYLTLPLPMKKERTLEVYLVRMDPLTKPMQYKVVVPKIGNILDLCTAL
SALSGIPADKMIVTDIYNHRFHRIFAMDENLSSIMERDDIYVFEININRTEDTEHVIIPV
CLREKFRHSSYTHHTGSSLFGQPFLMAVPRNNTEDKLYNLLLLRMCRYVKISTETEETEG
SLHCCKDQNINGNGPNGIHEEGSPSEMETDEPDDESSQDQELPSENENSQSEDSVGGDND
SENGLCTEDTCKGQLTGHKKRLFTFQFNNLGNTDINYIKDDTRHIRFDDRQLRLDERSFL
ALDWDPDLKKRYFDENAAEDFEKHESVEYKPPKKPFVKLKDCIELFTTKEKLGAEDPWYC
PNCKEHQQATKKLDLWSLPPVLVVHLKRFSYSRYMRDKLDTLVDFPINDLDMSEFLINPN
AGPCRYNLIAVSNHYGGMGGGHYTAFAKNKDDGKWYYFDDSSVSTASEDQIVSKAAYVLF
YQRQDTFSGTGFFPLDRETKGASAATGIPLESDEDSNDNDNDIENENCMHTN
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaggcggagcggcggatctggacacccagcggtctgacatcgcgacgctgctc
aaaacctcgctccggaaaggggacacctggtacctagtcgatagtcgctggttcaaacag
tggaaaaaatatgttggctttgacagctgggacaaataccagatgggagatcaaaatgtg
tatcctggacccattgataactctggacttctcaaagatggtgatgcccagtcacttaag
gaacatcttattgatgaattggattacatactgttgccaactgaaggttggaataaactt
gtcagctggtacacattgatggaaggtcaagagccaatagcacgaaaggtggttgaacag
ggtatgtttgtaaagcactgcaaagtagaagtatatctcacagaattgaagctatgtgaa
aatggaaacatgaacaatgttgtaactcgaagatttagcaaagctgacacaatagataca
attgaaaaggaaataagaaaaatcttcagtattccagatgaaaaggagaccagattgtgg
aacaaatacatgagtaatacatttgaaccactgaataaaccagacagcaccattcaggat
gctggtttataccaaggacaggtattagtgatagaacagaaaaatgaagatggaacatgg
ccaaggggtccttctactcctaatgtgaaaaactcaaattactgtctcccatcatatacg
gcttataagaactatgattattcagaacctggaagaaacaatgaacagccaggcctctgt
ggcctaagtaacttgggaaatacgtgtttcatgaactcagctattcagtgtttgagcaac
acacctccacttactgagtatttcctcaatgataagtatcaagaagaactgaattttgac
aatcccttaggaatgagaggtgaaatagctaaatcttatgccgaactgatcaagcaaatg
tggtctggaaagtttagctacgtcaccccaagagcctttaagacacaggtaggacgtttt
gcacctcagttctctggatatcagcagcaagactgtcaagaactattagctttcctatta
gatggattacatgaggatttgaatagaattaggaaaaaaccatatatacaattaaaagat
gcagatggaaggccagataaggtagttgccgaagaagcctgggaaaaccatttaaaacga
aatgattctatcatagtagatatatttcatggccttttcaaatcaactttagtttgtcct
gagtgtgctaagatttcagtaacatttgatcctttttgttacttgacacttccattgccc
atgaaaaaagaacgcactttggaagtttacttagttagaatggatccgcttaccaaacct
atgcagtacaaagtggttgtccccaaaattggaaatatattagatctttgtacagcattg
tctgctttgtcaggaatacctgcagataagatgatagttactgatatatacaatcataga
tttcacagaatattcgctatggatgaaaaccttagtagtattatggaacgggatgatatt
tatgtgtttgaaattaacatcaataggacagaagatacagagcatgtgattattcctgtt
tgcctaagagaaaaattcagacactcaagttatacccaccatactggttcttcacttttt
ggtcagccttttcttatggctgtaccacgaaacaatactgaagacaaactttataatctc
ctgctcttgagaatgtgccgatatgtcaaaatatctactgaaactgaagaaactgaagga
tccctacactgctgtaaggaccaaaatattaatgggaatggcccaaatggcatacatgaa
gaaggctcaccaagtgaaatggaaacagatgagccagatgatgaatccagccaggatcaa
gaacttccctcagagaatgaaaacagtcagtctgaagattcagttggaggagataatgat
tctgaaaatggattatgtactgaggacacttgcaaaggtcaactcacgggacacaaaaaa
cgattgtttacattccagttcaacaacttaggcaatactgatatcaactacatcaaagat
gataccagacatataagatttgatgataggcagcttaggctagatgaaagatcttttctt
gctttggattgggatcctgatttgaaaaaacgatattttgatgaaaatgctgctgaggac
tttgaaaaacatgaaagtgtggagtataaacctcctaaaaaaccctttgtgaaattaaaa
gattgcattgaactttttacaacaaaagaaaagctaggtgctgaagatccctggtattgt
ccgaattgtaaagaacatcagcaagccacaaagaaattggatttatggtccttgcctcca
gtacttgtagtacatctcaagcgattttcttacagtcgatacatgagagacaagttggat
accttagttgatttccctatcaatgacttggatatgtcggaattcttaattaatccaaat
gcaggtccttgccgctataatttgattgctgtttccaaccactatggagggatgggagga
ggacactatactgcttttgcaaaaaataaagatgatggaaaatggtactattttgatgac
agtagtgtctccactgcatctgaagaccaaattgtgtccaaagcagcatatgtactcttc
taccagagacaagacactttcagtggaactggcttttttcctcttgaccgagaaactaaa
ggtgcttcagctgccactggcatcccattagaaagtgatgaagatagcaatgataatgac
aatgatatagaaaatgaaaactgtatgcacactaactaa

DBGET integrated database retrieval system