KEGG   Macaca mulatta (rhesus monkey): 716857Help
Entry
716857            CDS       T01028                                 

Gene name
USP32
Definition
(RefSeq) ubiquitin specific peptidase 32
  KO
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.4.19.12]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     716857 (USP32)
Peptidases [BR:mcc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   716857 (USP32)
Ubiquitin system [BR:mcc04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    716857 (USP32)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
16
AA seq 1635 aa AA seqDB search
MCGVERGLWQSAQLARRGWRPFSQGYCQMLLILTPPVTDVELKRLKDAFKRTCGLSYYMG
QHCFIREVLGDGVPPKVAEVIYCSFGGTSKGLHFNNLIVGLVLLTRGKDEEKAKYIFSLF
SSESGNYVIREEMERMLHVVDGKVPDTLRKCFSEGEKVNYEKFRNWLFLNKDAFTFSRWL
LSGGVYVTLTDDSDTPTFYQTLAGVTHLEESDIIDLEKRYWLLKAQSRTGRFDLETFGPL
VSPPIRPSLSEGLFNAFDENRDNHIDFKEISCGLSACCRGPLAERQKFCFKVFDVDRDGV
LSRVELRDMVVALLEVWKDNRTDDIPELHMDLSDIVEGILNAHDTTKMGHLTLEDYQIWS
VKNVLANEFLNLLFQVCHIVLGLRPATPEEEGQIIRGWLERESRYGLQPGHNWFIISMQW
WQQWKEYVKYDTNPVVIEPSSVLNGGKYSFGTAVHPMEQVEDKIGSSLSYVNTTEEKFSD
NISTASEASETAGSGFLYSATPGADVCFARQHNTSDNNNQCLLGANGNILLHLNPQKPGA
IDNQPLVTQEPVKATSLTLEGGRLKQTPQLIHGRDYEMVPEPVWRALYHWYGANLALPRP
VIKNSKTDIPELELFPRYLLFLRQQPATRTQQSNIWVNMGMMSLRMFPQHFPRGNVPSPN
APLKRVLAYTGCFSRMQTIKEIHEYLSQRLRIKEEDMRLWLYNSENYLTLLDDEDHRLEY
LKIQDEQHLVIEVRNKDMSWPEEMSFIANSSKIDRHKVPTEKGATGLSNLGNTCFMNSSI
QCVSNTQPLTQYFISGRHLYELNRTNPIGMKGHMAKCYGDLVQELWSGTQKNVAPLKLRW
TIAKYAPRFNGFQQQDSQELLAFLLDGLHEDLNRVHEKPYVELKDSDGRPDWEVAAEAWD
NHLRRNRSIVVDLFHGQLRSQVKCKTCGHISVRFDPFNFLSLPLPMDSYMHLEITVIKLD
GTTPVRYGLRLNMDEKYTGLKKQLSDLCGLNSEQILLAEVHGSNIKNFPQDNQKVRLSVS
GFLCAFEIPVPASPISASSPTQTDFSSSPSTNGMFTLTTNGDLPRPIFIPNGMPNTVVPC
GTEKNFTNGMVNGHMSSLPDSPFTGYIIAVHRKMMRTELYFLSSQKNRPSLFGMPLIVPC
TVHTRKKDLYDAVWIQVSRLASPLPPQEASNHAQDCDDSMGYQYPFTLRVVQKDGNTCAW
CPWYRFCRGCKIDCGEDRAFIGNAYIAVDWDPTALHLRYQTSQERVVDEHESVEQSRRAQ
AEPINLDSCLRAFTSEEELGENEMYYCSKCKTHCLATKKLDLWRLPPILIIHLKRFQFVN
GRWIKSQKIVKFPRESFDPSAFLVPRDPALCRRKPLTPQGDELSEPRVLAREVKKVDAQS
SAGEEDVLLSKSPSSLSANIISSPKGSPSSSRKSGASCPSSKNSSPSSSPRTLGRSKGRL
RLPQIGSKNKLSSSKENLDASRDNGAGQICELADALSRGHMLGGSQPELVTPQDHEVALA
NGFLYEHEACGNGYSNGQLGNHSEEDSTDDQREDTRIKPIYNLYAISCHSGILGGGHYVT
YAKNPNCKWYCYNDSSCKELHPDEIDTDSAYILFYEQQGIDYAQFLPKIDGKKMADTSSM
DEDFESDYKKYCVLQ
NT seq 4908 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggggtcgagcgaggactttggcagagcgcacagctcgccaggagaggctggcgc
cccttctcccaagggtactgtcagatgctgttgattctgacaccacctgttacagatgta
gagctaaaacgactgaaggatgccttcaagaggacctgtggactctcatattacatgggc
cagcactgcttcatccgggaggtgcttggggatggagtgcctccaaaagttgctgaggtg
atctactgttcttttggtggaacatccaaaggactgcacttcaataatttaatagttgga
cttgtcctccttacaagaggcaaagatgaagagaaagcaaaatacatttttagtcttttt
tcaagtgaatctgggaactatgttatacgggaagaaatggaaagaatgctccatgtggtg
gatggtaaagtcccagatacactcaggaagtgtttctcagagggtgaaaaggtaaactat
gaaaagtttagaaattggctttttctaaacaaagatgcttttactttctctcgatggctt
ctatctggaggtgtgtatgttaccctcactgatgatagtgatactcctactttctaccaa
actctggctggagtcacgcatttggaggaatcagacatcattgatcttgagaaacgctat
tggttattgaaggctcagtcccggactggacgatttgatttagagacatttggcccattg
gtttcaccacctattcgtccatctctaagtgaaggtttgtttaatgcttttgatgaaaat
cgtgacaatcacatagattttaaggagatatcctgtgggttatcagcctgttgcagggga
cccctggctgaaagacaaaaattttgcttcaaggtatttgatgttgaccgtgatggagtt
ctctccagggttgaactgagagacatggtggttgcacttttagaagtctggaaggacaac
cgcactgatgatattcctgaattacatatggatctctctgacattgtagaaggcatattg
aatgcacatgacaccacaaagatgggtcatcttactctggaagactatcagatctggagt
gtgaaaaatgttcttgccaatgagtttttgaacctccttttccaggtgtgtcacatagtt
ctggggttaagaccagctactccggaagaagaaggacaaattattagaggatggttagaa
cgagagagcaggtatggtctgcaaccaggacacaactggtttatcatctccatgcagtgg
tggcagcagtggaaagaatatgtcaaatacgataccaaccctgtggtaattgagccatca
tctgttttgaatggaggaaaatactcatttggaactgcagtccatcctatggagcaggtc
gaagataaaattggaagcagcctcagttatgttaatactacagaagagaaattttcagac
aacatttctactgcatctgaagcctcagaaactgctggcagcggctttctgtattctgcc
acaccaggggcagatgtttgctttgctcgacaacataacacttctgacaataacaaccag
tgtttgctgggagccaatgggaatattttgttgcaccttaaccctcagaaaccaggggct
attgataatcagccgttagtaactcaagaaccagtaaaggctacatcattaacactagaa
ggaggacgattaaaacaaactccacagctgattcatggaagagattatgaaatggtccca
gaacctgtgtggagagcgctttatcattggtatggagcaaacctggccctacctagacca
gtgatcaagaacagcaagacagacatcccagagctggaattatttccccgctatcttctc
ttcctgagacagcagcctgccactcggacacagcagtctaacatctgggtgaatatgggt
atgatgagcctgagaatgtttcctcagcatttcccgagaggaaatgtaccttctccgaat
gcacctttaaagcgggtattagcctatacaggctgttttagtcgaatgcagaccatcaag
gaaattcacgaatatctgtctcaaaggctgcgcattaaagaggaagatatgcgcctgtgg
ctatacaacagtgagaactaccttactcttctggatgatgaggatcatagattggaatat
ttgaaaatccaggatgaacaacacctggtaattgaagttcgcaacaaagatatgagttgg
cctgaggagatgtcttttatagcaaatagtagtaaaatagatagacacaaggttcccaca
gaaaagggagccacaggtctaagcaacctgggaaacacatgcttcatgaactcaagcatc
cagtgtgttagtaacacacagccactgacacagtattttatctcagggagacatctttat
gaactcaacaggacaaatcccattggtatgaaggggcatatggctaaatgctatggtgat
ttagtacaggaactttggagtggaactcagaagaatgttgccccattaaagcttcggtgg
accatagcaaaatatgctcccaggtttaatgggtttcagcaacaagactcccaagaactt
ctggcttttctcttggatggtcttcatgaagatctcaaccgagtccatgaaaagccatat
gtggaactgaaggacagtgatggccgaccagactgggaagtagctgcagaggcctgggac
aaccatctaagaagaaatagatcaattgttgtggatttgttccatgggcagctaagatct
caagtcaaatgcaagacatgtgggcatataagtgtccgatttgaccctttcaattttttg
tctttgccactaccaatggacagttatatgcacttagaaataacagtgattaagttagat
ggtactacccctgtgcggtatggactaaggctgaatatggatgaaaagtacacaggttta
aaaaaacagctgagcgatctctgtggacttaattcagagcaaatccttctagcagaagta
catggttccaacataaagaactttcctcaggacaaccaaaaagtacgactctcagtgagt
ggatttttgtgtgcatttgaaattcctgtccctgcatctccaatttcagcttctagtcca
acacagacagatttctcctcttcgccatctacaaatggaatgttcaccttaactaccaat
ggggacctaccccgaccaatattcatccccaatggaatgccaaacactgttgtgccatgt
ggaactgagaagaacttcacaaatggaatggttaatggtcacatgtcatctcttcctgac
agcccctttacaggttacatcattgcagtccaccgaaaaatgatgaggacagaactgtat
ttcctgtcatctcagaagaatcgccccagcctctttggaatgccactgattgttccatgt
actgtgcatacccggaagaaagacctatatgatgcagtttggattcaagtgtcccggtta
gcgagcccactcccacctcaggaagctagtaatcatgcccaggattgtgatgatagtatg
ggctatcaatatccattcactctacgagttgtgcagaaagatgggaacacctgtgcttgg
tgcccatggtatagattttgccgaggctgtaaaattgattgtggggaagacagagctttc
attggaaatgcctatattgctgtggattgggaccccacagcccttcaccttcgctatcaa
acatcccaggaaagggttgtcgatgagcatgagagtgtggagcagagtcggcgagcacaa
gccgagcccatcaacctggacagctgtctccgtgctttcaccagtgaggaagagctaggg
gaaaatgagatgtactactgttccaagtgtaagacccactgcttagcaacaaagaagctg
gatctctggaggcttccacccatcctgattattcatcttaagcgatttcaatttgtaaat
ggtcggtggataaaatcacagaaaattgtcaaatttcctcgggaaagttttgatccaagt
gcttttttggtaccaagagacccggctctctgtcggcgtaaaccactcacaccccagggg
gatgagctttccgagccccgggttctggcaagagaggtgaagaaagtggatgcgcagagt
tcggctggggaagaggacgtgctcctgagcaaaagcccatcctcactcagcgctaacatc
atcagcagcccgaaaggttctccttcttcatcaagaaaaagtggagccagctgtccctcc
agcaaaaacagcagccctagtagcagcccacggactttggggaggagcaaagggaggctc
cggctgccccagattggcagcaaaaataaactgtcaagtagtaaggagaacttggatgcc
agcagagataatggggctgggcagatctgtgagctggctgacgccttgagccgagggcat
atgctggggggcagccagccagagttggtcactcctcaggaccacgaggtagctttggcc
aatggattcctttatgagcatgaagcatgtggcaatggctacagcaatggtcagcttgga
aaccacagtgaagaagacagcactgatgaccaaagagaagacactcgtattaagcctatt
tataatctatatgcaatttcgtgccattcaggaattctgggtgggggccattacgtcact
tatgccaaaaacccaaactgcaagtggtactgttacaatgacagcagctgtaaggaactt
caccctgatgaaattgacaccgactctgcctacattcttttctatgagcaacaggggata
gactatgcacaatttctgccaaagattgatggcaaaaagatggcagacacaagcagtatg
gatgaagactttgagtctgattacaaaaagtactgtgtgttacagtaa

DBGET integrated database retrieval system