KEGG   Macaca mulatta (rhesus monkey): 716857Help
Entry
716857            CDS       T01028                                 

Definition
ubiquitin carboxyl-terminal hydrolase 32-like
Orthology
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.1.2.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 1535 aa AA seqDB search
MIFPKVEGSYVIAQNSYHIIVAVGGPLYSRTVVIYCSFGGTSKGLHFNNLIVGLVLLTRG
KDEEKAKYIFSLFSSESGNYVIREEMERMLHVVDGKVPDTLRKCFSEGEKVNYEKFRNWL
FLNKDAFTFSRWLLSGGVYVTLTDDSDTPTFYQTLAGVTHLEESDIIDLEKRYWLLKAQS
RTGRFDLETFGPLVSPPIRPSLSEGLFNAFDENRDNHIDFKEISCGLSACCRGPLAERQK
FCFKVFDVDRDGVLSRVELRDMVVALLEVWKDNRTDDIPELHMDLSDIVEGILNAHDTTK
MGHLTLEDYQIWSVKNVLANEFLNLLFQVCHIVLGLRPATPEEEGQIIRGWLERESRYGL
QPGHNWFIISMQWWQQWKEYVKYDTNPVVIEPSSVLNGGKYSFGTAVHPMEQVEDKIGSS
LSYVNTTEEKFSDNISTAFEASETAGSGFLYSATPGADVCFARQHNTXATSLTLEGGRLK
QTPQLIHGRDYEMVPEPVWRALYHWYGANLALPRPVIKNSKTDIPELELFPRYLLFLRQQ
PATRTQQSNIWVNMGNVPSPNAPLKRVLAYTGCFSRMQTIKEIHEYLSQRLRIKEEDMRL
WLYNSENYLTLLDDEDHRLEYLKIQDEQHLVIEVRNKDMSWPEEMSFIANSSKIDRHKVP
TEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQYFISGRHLYELNRTNPIGMKGHMAKCYG
DLVQELWSGTQKNVAPLKLRWTIAKYAPRFNGFQQQDSQELLAFLLDGLHEDLNRVHEKP
YVELKDSDGRPDWEVAAEAWDNHLRRNRSIVVDLFHGQLRSQVKCKTCGHISVRFDPFNF
LSLPLPMDSYMHLEITVIKLDGTTPVRYGLRLNMDEKYTGLKKQLSDLCGLNSEQILLAE
VHGSNIKNFPQDNQKVRLSVSGFLCAFEIPVPASPISASSPTQTDFSSSPSTNGMFTLTT
NGDLPRPIFIPNGMPNTVVPCGTEKNFTNGMVNGHMSSLPDSPFTGYIIAVHRKMMRTEL
YFLSSQKNRPSLFGMPLIVPCTVHTRKKDLYDAVWIQVSRLASPLPPQEASNHAQDXFGY
GYQWSFTGRVMQKDENSCVRCPLFRFCRGCKIDCGEDRAFIGNAYIAVDWDPTALHLRYQ
TSQERVVDEHESVEQSRRAQAEPINLDSCLRAFTSEEELGENEMYYCSKCKTHCLATKKL
DLWRLPPILIIHLKRFQFVNGRWIKSQKIVKFPRESFDPSAFLVPRDPALCRRKPLTPQG
DELSEPRVLAREVKKVDAQSSAGEEDVLLSKSPSSLSANIISSPKGSPSSSRKSGASCPS
SKNSSPSSSPRTLGRSKGRLRLPQIGSKNKLSSSKENLDASRDNGAGQICELADALSRGH
MLGGSQPELVTPQDHEVALANGFLYEHEACGNGYSNGQLGNHSEEDSTDDQREDTRIKPI
YNLYAISCHSGILGGGHYVTYAKNPNCKWYCYNDSSCKELHPDEIDTDSAYILFYEQQGI
DYAQFLPKIDGKKMADTSSMDEDFESDYKKYCVLQ
NT seq 4608 nt NT seq  +upstreamnt  +downstreamnt
atgatatttccaaaggttgaaggaagttatgtaattgcacaaaattcttatcacattatt
gtggctgttggaggacctttgtactctcggaccgtggtgatctactgttcttttggtgga
acatccaaaggactgcacttcaataatttaatagttggacttgtcctccttacaagaggc
aaagatgaagagaaagcaaaatacatttttagtcttttttcaagtgaatctgggaactat
gttatacgggaagaaatggaaagaatgctccatgtggtggatggtaaagtcccagataca
ctcaggaagtgtttctcagagggtgaaaaggtaaactatgaaaagtttagaaattggctt
tttctaaacaaagatgcttttactttctctcgatggcttctatctggaggtgtgtatgtt
accctcactgatgatagtgatactcctactttctaccaaactctggctggagtcacgcat
ttggaggaatcagacatcattgatcttgagaaacgctattggttattgaaggctcagtcc
cggactggacgatttgatttagagacatttggcccattggtttcaccacctattcgtcca
tctctaagtgaaggtttgtttaatgcttttgatgaaaatcgtgacaatcacatagatttt
aaggagatatcctgtgggttatcagcctgttgcaggggacccctggctgaaagacaaaaa
ttttgcttcaaggtatttgatgttgaccgtgatggagttctctccagggttgaactgaga
gacatggtggttgcacttttagaagtctggaaggacaaccgcactgatgatattcctgaa
ttacatatggatctctctgacattgtagaaggcatattgaatgcacatgacaccacaaag
atgggtcatcttactctggaagactatcagatctggagtgtgaaaaatgttcttgccaat
gagtttttgaacctccttttccaggtgtgtcacatagttctggggttaagaccagctact
ccggaagaagaaggacaaattattagaggatggttagaacgagagagcaggtatggtctg
caaccaggacacaactggtttatcatctccatgcagtggtggcagcagtggaaagaatat
gtcaaatacgataccaaccctgtggtaattgagccatcatctgttttgaatggaggaaaa
tactcatttggaactgcagtccatcctatggagcaggtcgaagataaaattggaagcagc
ctcagttatgttaatactacagaagagaaattttcagacaacatttctactgcatttgaa
gcctcagaaactgctggcagcggctttctgtattctgccacaccaggggcagatgtttgc
tttgctcgacaacataacacttnngctacatcattaacactagaaggaggacgattaaaa
caaactccacagctgattcatggaagagattatgaaatggtcccagaacctgtgtggaga
gcgctttatcattggtatggagcaaacctggccctacctagaccagtgatcaagaacagc
aagacagacatcccagagctggaattatttccccgctatcttctcttcctgagacagcag
cctgccactcggacacagcagtctaacatctgggtgaatatgggaaatgtaccttctccg
aatgcacctttaaagcgggtattagcctatacaggctgttttagtcgaatgcagaccatc
aaggaaattcacgaatatctgtctcaaaggctgcgcattaaagaggaagatatgcgcctg
tggctatacaacagtgagaactaccttactcttctggatgatgaggatcatagattggaa
tatttgaaaatccaggatgaacaacacctggtaattgaagttcgcaacaaagatatgagt
tggcctgaggagatgtcttttatagcaaatagtagtaaaatagatagacacaaggttccc
acagaaaagggagccacaggtctaagcaacctgggaaacacatgcttcatgaactcaagc
atccagtgtgttagtaacacacagccactgacacagtattttatctcagggagacatctt
tatgaactcaacaggacaaatcccattggtatgaaggggcatatggctaaatgctatggt
gatttagtacaggaactttggagtggaactcagaagaatgttgccccattaaagcttcgg
tggaccatagcaaaatatgctcccaggtttaatgggtttcagcaacaagactcccaagaa
cttctggcttttctcttggatggtcttcatgaagatctcaaccgagtccatgaaaagcca
tatgtggaactgaaggacagtgatggccgaccagactgggaagtagctgcagaggcctgg
gacaaccatctaagaagaaatagatcaattgttgtggatttgttccatgggcagctaaga
tctcaagtcaaatgcaagacatgtgggcatataagtgtccgatttgaccctttcaatttt
ttgtctttgccactaccaatggacagttatatgcacttagaaataacagtgattaagtta
gatggtactacccctgtgcggtatggactaaggctgaatatggatgaaaagtacacaggt
ttaaaaaaacagctgagcgatctctgtggacttaattcagagcaaatccttctagcagaa
gtacatggttccaacataaagaactttcctcaggacaaccaaaaagtacgactctcagtg
agtggatttttgtgtgcatttgaaattcctgtccctgcatctccaatttcagcttctagt
ccaacacagacagatttctcctcttcgccatctacaaatggaatgttcaccttaactacc
aatggggacctaccccgaccaatattcatccccaatggaatgccaaacactgttgtgcca
tgtggaactgagaagaacttcacaaatggaatggttaatggtcacatgtcatctcttcct
gacagcccctttacaggttacatcattgcagtccaccgaaaaatgatgaggacagaactg
tatttcctgtcatctcagaagaatcgccccagcctctttggaatgccactgattgttcca
tgtactgtgcatacccggaagaaagacctatatgatgcagtttggattcaagtgtcccgg
ttagcgagcccactcccacctcaggaagctagtaatcatgcccaggattgatttggatat
ggctatcaatggtcattcactggacgagttatgcagaaagatgagaactcctgtgtcaga
tgcccactttttagattttgccgaggctgtaaaattgattgtggggaagacagagctttc
attggaaatgcctatattgctgtggattgggaccccacagcccttcaccttcgctatcaa
acatcccaggaaagggttgtcgatgagcatgagagtgtggagcagagtcggcgagcacaa
gccgagcccatcaacctggacagctgtctccgtgctttcaccagtgaggaagagctaggg
gaaaatgagatgtactactgttccaagtgtaagacccactgcttagcaacaaagaagctg
gatctctggaggcttccacccatcctgattattcatcttaagcgatttcaatttgtaaat
ggtcggtggataaaatcacagaaaattgtcaaatttcctcgggaaagttttgatccaagt
gcttttttggtaccaagagacccggctctctgtcggcgtaaaccactcacaccccagggg
gatgagctttccgagccccgggttctggcaagagaggtgaagaaagtggatgcgcagagt
tcggctggggaagaggacgtgctcctgagcaaaagcccatcctcactcagcgctaacatc
atcagcagcccgaaaggttctccttcttcatcaagaaaaagtggagccagctgtccctcc
agcaaaaacagcagccctagtagcagcccacggactttggggaggagcaaagggaggctc
cggctgccccagattggcagcaaaaataaactgtcaagtagtaaggagaacttggatgcc
agcagagataatggggctgggcagatctgtgagctggctgacgccttgagccgagggcat
atgctggggggcagccagccagagttggtcactcctcaggaccacgaggtagctttggcc
aatggattcctttatgagcatgaagcatgtggcaatggctacagcaatggtcagcttgga
aaccacagtgaagaagacagcactgatgaccaaagagaagacactcgtattaagcctatt
tataatctatatgcaatttcgtgccattcaggaattctgggtgggggccattacgtcact
tatgccaaaaacccaaactgcaagtggtactgttacaatgacagcagctgtaaggaactt
caccctgatgaaattgacaccgactctgcctacattcttttctatgagcaacaggggata
gactatgcacaatttctgccaaagattgatggcaaaaagatggcagacacaagcagtatg
gatgaagactttgagtctgattacaaaaagtactgtgtgttacagtaa

DBGET integrated database retrieval system