KEGG   Macaca mulatta (rhesus monkey): 716923Help
Entry
716923            CDS       T01028                                 

Gene name
USP25
Definition
ubiquitin specific peptidase 25
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 1104 aa AA seqDB search
AGGGARSRAPPPPPRGAKTVEQNVLQQSAALKHQQTFLNQLREITGINDTQILQQALKDS
NGNLELAVAFLTAKNAKTPQQEEATYYQTALPGNDRYISVGSQADTNVIDLTGDDKDDLQ
RAIALSLAESNRAFRETGITDEEQAISRVLEASIAENKACLKRTPTEVWRDSRNPYDRKR
QDKAPVGLKNVGNTCWFSAVIQSLFNLLEFRRLVLNYKPPSNAQDLPRNQKEHRNLPFMR
ELRYLFALLVGTKRKYVDPSRAVEILKDAFKSNDSQQQDVSEFTHKLLDWLEDAFQMKAE
EETDEEKPKNPMVELFYGRFLAVGVLEGKKFENTEMFGQYPLQVNGFKDLHECLEAAMIE
GEIESLHSENSGKSGQEHWFTELPPVLTFELSRFEFNQALGRPEKIHNKLEFPQVLYLDR
YMHRNREITRIKREEIKRLKDYLTVLQQRLERYLSYGSGPKRFPLVDVLQYALEFASSKP
VCTSPVDDIDASSPPSGSIPSQTLPSTTEQQGAPSSELPSTSPSSVAAVSSRSVIHKPFT
QSRIPPDLPMHPAPRHITEEELSVLESCLHRWRTEIENDTRDLQESISRIHRTIELMYSD
KSMIQVPYRLHAVLVHEGQANAGHYWAYIFDHRESRWMKYNDIAVTKSSWEELVRDSFGG
YRNASAYCLMYINDKAQFLIQEEFNKETGQPLVGIETLPPDLRDFVEEDNQRFEKELEEW
DAQLAQKALQEKLLASQKLRESETSVTTAQAAGDPEYLEQPSRSDFSKHLKEETIRIITK
ASHEHEDKSPETVLQSIMMTPNMQGIIMAIGKSRSVYDRCGPEAGFFKAIKLEYARLVKL
AQEDTPPETDYRLHHVVVYFIQNQTPKKIIEKTLLEQFGDRNLSFDERCHNIMKVAQAKL
EMIKPEEVNLEEYEEWHQDYRKFRETTMYLIIGLENFQRESYIDSLLFLICAYQNNKELL
SKGLYRGHDEELISHYRRECLLKLNEQAAELFESGEDREVNNGLIIMNEFIVPFLPLLLV
DEMEEKDILAVEDMRNRWCSYLGQEMEPHLQEKLTDFLPKLLDCSMEIKSFHEPPKLPSY
STHELCERFARIMLSLSRTPADGR
NT seq 3315 nt NT seq  +upstreamnt  +downstreamnt
gccggcggaggcgcgaggagccgggcgccgccgccgccgccgcggggcgctaagaccgtg
gagcagaacgtgctgcagcagagcgcggcccttaagcaccagcaaacgtttttgaatcaa
ctgagagaaattactgggattaatgacacccagatactacagcaagccttgaaggatagt
aatggaaacttggaattagcagtggctttccttactgcgaagaatgctaagacccctcag
caggaggaggcaacttactaccaaacagcacttcctggcaatgatagatacatcagtgtg
ggaagccaggcagatacaaatgtgattgatctcactggagatgataaagatgatcttcag
agagcaattgccttgagtttggccgaatcaaacagggcattcagggagactggaataact
gatgaggaacaagccattagcagagttcttgaagccagcatagcagagaataaagcatgt
ttgaagaggacacctacagaagtttggagggattctcgaaacccttatgatagaaaaaga
caggacaaagctcccgttgggctaaagaatgttggcaatacttgttggtttagtgctgtt
attcagtcattatttaatcttttggaatttagaagattagttctgaattacaagcctcca
tcaaatgctcaagatttaccccgaaaccaaaaggaacatcggaatttgccttttatgcgt
gagctgaggtatctatttgcacttcttgttggtaccaaaaggaagtatgttgatccatca
agagcagttgaaattcttaaggatgctttcaaatcaaatgactcacagcagcaagatgtg
agtgagtttacacacaaattattagattggttagaagatgccttccaaatgaaagctgaa
gaggagacggatgaagagaagccaaagaaccccatggtagagttgttctatggaagattc
ctagccgtgggagtacttgaaggtaaaaaatttgaaaacactgaaatgtttggtcagtac
ccacttcaggtcaatgggttcaaagatctgcatgagtgcctagaggctgcgatgattgaa
ggagaaattgagtctttacattcagagaattcaggaaaatcaggccaagagcattggttt
actgaattaccacctgtgttaacatttgaattgtcaagatttgaatttaatcaggcattg
ggaagaccagaaaaaattcacaacaaattagaatttccccaagttttatatttggacaga
tacatgcacagaaacagagaaataacgagaattaagagggaagagatcaagagactgaaa
gattacctcacagtattacaacaaaggcttgaaagatacttaagctatggttcgggtccc
aaacgattccccttggtagatgttcttcagtatgcattggaatttgcctcaagtaaacct
gtttgcacttctcctgttgacgatattgatgctagttccccacctagtggttccatacca
tcacagacgttaccaagcacaacagaacaacagggagccccatcttcagaactgccaagc
acgtcgccttcatcagttgctgccgtttcatcgagatcagtgatacacaaaccatttact
cagtcccggatacctccagatttgcccatgcatccggcaccaaggcacattacggaggaa
gaactttctgtgctggaaagttgtttacatcgctggaggacagaaatagaaaatgacacc
agagatttgcaggaaagcatatccagaatccatcgaacaattgaactaatgtactctgac
aaatctatgatacaagttccttaccgattacatgccgttttagttcatgaaggccaagct
aatgctgggcactactgggcatatatttttgatcatcgtgaaagcagatggatgaagtac
aatgatattgctgtgacaaaatcatcatgggaagagctagtgagggactcttttggtggt
tatagaaatgccagtgcatactgtttaatgtacataaatgataaggcacagttcttaata
caagaagagtttaataaagaaactgggcagccccttgttggtatagaaacattacccccg
gatttgagagattttgttgaggaagacaaccaacgatttgaaaaagaactagaagaatgg
gatgcacaacttgcccagaaagctttgcaggaaaagcttttagcgtctcagaaattgaga
gagtcagagacttctgtgacaacagcacaagcagcaggagacccagaatatctagagcag
ccatcaagaagtgatttctcaaagcacttgaaagaagaaactattcgaataattaccaag
gcatcacatgagcatgaagataaaagtcctgaaacagttttgcagtcgatcatgatgaca
ccgaacatgcaaggtattatcatggcgataggtaaatccaggagtgtatatgacaggtgt
ggccctgaagcagggttctttaaggcaattaagttggaatatgcaaggttggttaagttg
gcccaagaagacaccccaccagaaaccgactatcgtttacatcatgtcgtggtctacttt
atccagaaccagacaccaaagaaaatcattgagaaaacattgctagaacaatttggagac
agaaatttgagttttgatgaaaggtgtcacaacataatgaaagttgctcaagccaaactg
gaaatgataaaacctgaagaagtaaacttggaagaatatgaggagtggcatcaggattat
aggaaattcagggaaacaactatgtatctcataattggactagaaaattttcaaagagaa
agttatatagattccttgctgttcctcatctgtgcttatcagaataataaagaactcctg
tctaaaggcttatacagaggacatgatgaagaattgatatcacattataggagagaatgt
ttactaaaattaaatgagcaagccgcagaactcttcgaatctggagaggatcgagaagta
aacaatggtctgattatcatgaatgagtttattgtcccatttttgccattattactggtg
gatgaaatggaagagaaggatatactagctgtagaagatatgagaaatcgatggtgttcc
tacctcggtcaagaaatggaaccacacctccaagaaaagctgacagattttttgccaaaa
ctgcttgattgttctatggagattaaaagtttccatgagccaccgaagttaccttcgtat
tccacgcatgaactctgtgagcgatttgcccgaatcatgttgtccctcagtcgaactcct
gctgatggaagataa

DBGET integrated database retrieval system