KEGG   Macaca mulatta (rhesus monkey): 717020Help
Entry
717020            CDS       T01028                                 

Gene name
CYP21A2
Definition
(RefSeq) cytochrome P450, family 21, subfamily A, polypeptide 2 (EC:1.14.99.10)
  KO
K00513  
steroid 21-monooxygenase [EC:1.14.14.16]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Aldosterone synthesis and secretion
Module
C21-Steroid hormone biosynthesis, progesterone => corticosterone/aldosterone
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    717020 (CYP21A2)
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    717020 (CYP21A2)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     717020 (CYP21A2)
Cytochrome P450 [BR:mcc00199]
 Cytochrome P450, animal type
  CYP21 family
   717020 (CYP21A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 495 aa AA seqDB search
MLFLGLLLLLPLLAGARLLWNRWKLRSLHLPPLVPGFLHLLQPDLPIYLLGLTQKFGPIY
RLHLGLQDVVVLNSKRTIEEAMVKKWADFAGRPEPLTYKLVSKNYPDLSLGDYSLLWKAH
KKLTRSALLLGMRDSMEPVVEQLTQEFCERMRAQAGTPVAIEEEFSLLTCSIICHLTFGD
KIKEDNLVPAYYKCIQEVLKTWSHWSIQIVDVIPFLRFFPNPGLRRLKQAIEKRDHIVEK
QLRQHKESLVAGQWRDMMDYMLQVVAQPSMEEGSGQLLEGHVHMAAVDLLIGGTETTANT
LSWAVVFLLHHPEIQQRLQEELDHELGPSASSSRVPYKDRARLPLLNATIAEVLRLRPVV
PLALPHRTTRPSSISGYDIPEGTVIIPNLQGAHLDEMVWERPHEFWPDRFLEPGKNSRAL
AFGCGARVCLGEPLARLELFVVLTRLLQAFTLLPPGDALPSLQPLPHCSVILKMQPFQVW
LQPRGLGVHSLGQSQ
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgctgttcctggggctgctgctgctgctgcccctgctggctggcgcccgcctgctgtgg
aaccgctggaagctcaggagcctccacctcccgcctcttgtcccgggcttcctgcacctg
ctgcagcccgacctccccatctatctgcttggtctgactcagaaattcgggcccatctat
aggctccaccttgggctgcaagatgtggtggtgctgaactccaagaggaccattgaggaa
gccatggtcaaaaagtgggcagactttgctggcagacctgagccacttacctacaagctg
gtgtctaagaactacccggatctgtccttgggagactactctctgctctggaaagcccac
aagaagctcacccgctcagccctgctgctgggcatgcgtgactccatggagcccgtggtg
gagcagctgacccaggagttctgcgagcgcatgagagcccaggccggcacccctgtggcc
attgaggaggaattctctctcctcacctgcagcatcatctgtcacctcaccttcggagac
aagatcaaggaggacaacttagtgcctgcctattacaaatgtatccaggaggtgttaaaa
acctggagccactggtccatccaaattgtggacgtgattccctttctcaggttcttcccc
aatccaggtctccggagactgaagcaggccattgagaagagggaccacatcgtggagaag
cagctgaggcagcacaaggagagcttggtggcaggccagtggagggacatgatggactac
atgctccaggtggtggcacagccgagcatggaagagggctctggacagctcctggaaggg
cacgtgcacatggctgcagtggacctcctcatcggtggcactgagaccaccgcaaacact
ctctcctgggccgtggtttttttacttcaccaccctgagattcagcagcgactgcaggag
gagctagaccacgaactaggccccagtgcctccagctcccgggtcccctacaaggaccgt
gcacggctgcccttgctcaatgccaccatcgctgaggtgctgcgcctgcggcccgttgtg
cccctggccctgccccaccgcaccacacggcccagcagcatctccggctatgacatccct
gagggcacagtcatcatcccgaacctccaaggcgcccacctggatgagatggtctgggag
aggccacatgagttctggcctgatcgcttcctggagccaggcaagaactccagagcgctg
gccttcggctgcggggcgcgtgtgtgcctgggagagcccttggcgcgcctggagctcttc
gtggtgctgacccgactgctgcaggccttcacgctgctgcccccgggggacgccctgccc
tccctgcagcccctgccccactgcagtgtcatcctcaagatgcagcctttccaagtgtgg
ctgcagccccgggggttgggggtccacagcctgggccagagccagtga

DBGET integrated database retrieval system