KEGG   Macaca mulatta (rhesus monkey): 717020Help
Entry
717020            CDS       T01028                                 

Gene name
CYP21A2
Definition
cytochrome P450, family 21, subfamily A, polypeptide 2 (EC:1.14.99.10)
Orthology
K00513  
steroid 21-monooxygenase [EC:1.14.99.10]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C21-Steroid hormone biosynthesis, progesterone => corticosterone/aldosterone
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:mcc00140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 495 aa AA seqDB search
MLFLGLLLLLPLLAGARLLWNRWKLRSLHLPPLVPGFLHLLQPDLPIYLLGLTQKFGPIY
RLHLGLQDVVVLNSKRTIEEAMVKKWADFAGRPEPLTYKLVSKNYPDLSLGDYSLLWKAH
KKLTRSALLLGMRDSMEPVVEQLTQEFCERMRAQAGTPVAIEEEFSLLTCSIICHLTFGD
KIKEDNLVPAYYKCIQEVLKTWSHWSIQIVDVIPFLRFFPNPGLRRLKQAIEKRDHIVEK
QLRQHKESLVAGQWRDMMDYMLQVVAQPSMEEGSGQLLEGHVHMAAVDLLIGGTETTANT
LSWAVVFLLHHPEIQQRLQEELDHELGPSASSSRVPYKDRARLPLLNATIAEVLRLRPVV
PLALPHRTTRPSSISGYDIPEGTVIIPNLQGAHLDEMVWERPHEFWPDRFLEPGKNSRAL
AFGCGARVCLGEPLARLELFVVLTRLLQAFTLLPPGDALPSLQPLPHCSVILKMQPFQVW
LQPRGLGVHSLGQSQ
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgctgttcctggggctgctgctgctgctgcccctgctggctggcgcccgcctgctgtgg
aaccgctggaagctcaggagcctccacctcccgcctcttgtcccgggcttcctgcacctg
ctgcagcccgacctccccatctatctgcttggtctgactcagaaattcgggcccatctat
aggctccaccttgggctgcaagatgtggtggtgctgaactccaagaggaccattgaggaa
gccatggtcaaaaagtgggcagactttgctggcagacctgagccacttacctacaagctg
gtgtctaagaactacccggatctgtccttgggagactactctctgctctggaaagcccac
aagaagctcacccgctcagccctgctgctgggcatgcgtgactccatggagcccgtggtg
gagcagctgacccaggagttctgcgagcgcatgagagcccaggccggcacccctgtggcc
attgaggaggaattctctctcctcacctgcagcatcatctgtcacctcaccttcggagac
aagatcaaggaggacaacttagtgcctgcctattacaaatgtatccaggaggtgttaaaa
acctggagccactggtccatccaaattgtggacgtgattccctttctcaggttcttcccc
aatccaggtctccggagactgaagcaggccattgagaagagggaccacatcgtggagaag
cagctgaggcagcacaaggagagcttggtggcaggccagtggagggacatgatggactac
atgctccaggtggtggcacagccgagcatggaagagggctctggacagctcctggaaggg
cacgtgcacatggctgcagtggacctcctcatcggtggcactgagaccaccgcaaacact
ctctcctgggccgtggtttttttacttcaccaccctgagattcagcagcgactgcaggag
gagctagaccacgaactaggccccagtgcctccagctcccgggtcccctacaaggaccgt
gcacggctgcccttgctcaatgccaccatcgctgaggtgctgcgcctgcggcccgttgtg
cccctggccctgccccaccgcaccacacggcccagcagcatctccggctatgacatccct
gagggcacagtcatcatcccgaacctccaaggcgcccacctggatgagatggtctgggag
aggccacatgagttctggcctgatcgcttcctggagccaggcaagaactccagagcgctg
gccttcggctgcggggcgcgtgtgtgcctgggagagcccttggcgcgcctggagctcttc
gtggtgctgacccgactgctgcaggccttcacgctgctgcccccgggggacgccctgccc
tccctgcagcccctgccccactgcagtgtcatcctcaagatgcagcctttccaagtgtgg
ctgcagccccgggggttgggggtccacagcctgggccagagccagtga

DBGET integrated database retrieval system