KEGG   Macaca mulatta (rhesus monkey): 717129Help
Entry
717129            CDS       T01028                                 

Definition
ras-specific guanine nucleotide-releasing factor 1-like
Orthology
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
Ras signaling pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    717129
   04010 MAPK signaling pathway
    717129
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    717129
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 560 aa AA seqDB search
KGSSQDIDHLDFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAF
EENSKVTVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSID
FLNTFLHSYRVFTTAVVVLDKLITIYKKPISAIPARSLELLFASGQNNKLLYGDPPKSPR
ATRKFSSPPPLSITKTSSPSRRRKLSLNIPIITGGKALDLAALSCNSNGYTSMYSAMSPF
SKATLDTSKLYVSSSFTNKIPDEGDTTPEKPEDPSVLSKQSSEVSVREESDTDQNQSDDG
DTETSPTKSPTTPKSVKSKNSSEFPLFSYNNGVVMTSCRELDNNRSALSAASAFAIATAG
ANEGTPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETN
DELKCKVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEITQMCPATAHF
FPKEAHLECLPLKSMRAPCSFVNSLRFFQNKQPLSCPLLSPERVPLGPTVPGPLGHKPPS
SLSLPLALSVQPNPRAPDGK
NT seq 1682 nt NT seq  +upstreamnt  +downstreamnt
ccaaaggatccagccaagacatagatcacttggattttaaaatcggggtggagccaaagg
attccccgccctttacggtcatcctagtggcctcgtccagacaggagaaggcggcgtgga
ccagtgacatcagccagtgtgtggataacatccgatgcaatgggctcatgatgaacgcgt
ttgaagaaaattccaaggtcactgtgccacagatgatcaagtctgacgcctccttatatt
gtgatgatgttgacattcgcttcagcaaaaccatgaactcctgcaaagtgcttcagatcc
gctacgccagcgtggagcggctgctggagaggctgacagacctgcgcttcctgagcatcg
acttcctcaacaccttcctgcactcctaccgggtcttcaccaccgccgtcgtggtcctgg
acaagctcattaccatctacaagaagcctatcagtgccatacctgccaggtcgctggagc
ttctgtttgccagtggccagaacaacaaacttctgtacggtgacccccccaagtccccgc
gcgccacccgcaagttctcctcgccaccacctctgtccatcaccaagacatcttcgccaa
gccgccggcggaagctctccctgaacatccccattatcaccggcggcaaggccctggacc
tggccgccctcagctgcaactccaatggctacaccagcatgtactcggccatgtcaccct
tcagcaaggccacactggacaccagcaagctctatgtgtccagcagcttcaccaacaaga
ttccagatgagggcgatacgacccctgagaagcccgaagacccttcagtgctcagcaagc
agagctcagaagtctccgtgagagaggagtcagatactgatcaaaaccagagtgatgatg
gtgatactgaaacatcaccaactaaatctccaacaacacccaaatcagtcaaaagcaaaa
attcttcagagttcccgcttttttcctataacaacggagtcgtcatgacctcctgtcgcg
aactggacaataaccgcagtgccttgtcagctgcctccgcctttgccatagcaaccgcgg
gggccaacgagggcaccccaaacaaggagaagtaccggaggatgtccttagccagtgcag
ggtttcccccagaccagaggaatggagacaaggagtttgtgatccgcagagcagccacca
atcgtgtcttgaacgtgctccgccactgggtgtccaagcactctcaggactttgaaacca
acgatgagctcaaatgcaaggtgatcggcttcctggaagaagtcatgcacgacccggagc
tcctgacccaggagcggaaggctgcagccaacatcatcaggactctgacccaggaggacc
caggtgacaaccagatcacgctggaggagatcacacagatgtgtcctgctacagcccact
tttttccaaaagaggcccacctggaatgtttacccctcaagagcatgagggccccttgtt
ccttcgtgaacagcctgaggttcttccagaacaaacagccgctgagctgcccgctcttgt
ccccagagcgcgtgcctctgggccccacagtgcctgggcctctgggccataagccaccca
gctccttgagcttacccttggccctgtcagttcagcccaaccccagggcaccagatggga
ag

DBGET integrated database retrieval system