KEGG   Macaca mulatta (rhesus monkey): 717129Help
Entry
717129            CDS       T01028                                 

Definition
(RefSeq) ras-specific guanine nucleotide-releasing factor 1-like
  KO
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
Ras signaling pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    717129
   04010 MAPK signaling pathway
    717129
 Cellular Processes
  Cellular community
   04510 Focal adhesion
    717129
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 793 aa AA seqDB search
MSEKGKITRGRLGSLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLE
EPESTEEEAKGSSQDIDHLDFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVDNIR
CNGLMMNAFEENSKVTVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERL
TDLRFLSIDFLNTFLHSYRVFTTAVVVLDKLITIYKKPISAIPARWLRSLELLFASGQNN
KLLYGDPPKSPRATRKFSSPPPLSITKTSSPSRRRKLSLNIPIITGGKALDLAALSCNSN
GYTSMYSAMSPFSKATLDTSKLYVSSSFTNKIPDEGDTTPEKPEDPSVLSKQSSEVSVRE
ESDTDQNQSDDGDTETSPTKSPTTPKSVKSKNSSEFPLFSYNNGVVMTSCRELDNNRSAL
SAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRH
WVSKHSQDFETNDELKCKVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLE
EITQMAEGVKAEPFENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIM
KTTKHFNDISNLIASEIIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSA
IFRLKKTWLKVSKQTKALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFI
EEGTPNYTEDGLVNFSKMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESL
YESSLRIEPKLPT
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaagggcaagatcaccagagggcgcctggggtctctctccctaaagaaagag
ggtgaacgacagtgcttcctgttttctaagcatctgattatctgtaccagaggctctgga
gggaagcttcacctgaccaagaatggagtcatatccctcattgactgcactttattggag
gagccagaaagcacggaggaggaagccaaaggatccagccaagacatagatcacttggat
tttaaaatcggggtggagccaaaggattccccgccctttacggtcatcctagtggcctcg
tccagacaggagaaggcggcgtggaccagtgacatcagccagtgtgtggataacatccga
tgcaatgggctcatgatgaacgcgtttgaagaaaattccaaggtcactgtgccacagatg
atcaagtctgacgcctccttatattgtgatgatgttgacattcgcttcagcaaaaccatg
aactcctgcaaagtgcttcagatccgctacgccagcgtggagcggctgctggagaggctg
acagacctgcgcttcctgagcatcgacttcctcaacaccttcctgcactcctaccgggtc
ttcaccaccgccgtcgtggtcctggacaagctcattaccatctacaagaagcctatcagt
gccatacctgccaggtggctgaggtcgctggagcttctgtttgccagtggccagaacaac
aagcttctgtacggtgacccccccaagtccccgcgcgccacccgcaagttctcctcgcca
ccacctctgtccatcaccaagacatcttcgccaagccgccggcggaagctctccctgaac
atccccattatcaccggcggcaaggccctggacctggccgccctcagctgcaactccaat
ggctacaccagcatgtactcggccatgtcacccttcagcaaggccacactggacaccagc
aagctctatgtgtccagcagcttcaccaacaagattccagatgagggcgatacgacccct
gagaagcccgaagacccttcagtgctcagcaagcagagctcagaagtctccgtgagagag
gagtcagatactgatcaaaaccagagtgatgatggtgatactgaaacatcaccaactaaa
tctccaacaacacccaaatcagtcaaaagcaaaaattcttcagagttcccgcttttttcc
tataacaacggagtcgtcatgacctcctgtcgcgaactggacaataaccgcagtgccttg
tcagctgcctccgcctttgccatagcaaccgcgggggccaacgagggcaccccaaacaag
gagaagtaccggaggatgtccttagccagtgcagggtttcccccagaccagaggaatgga
gacaaggagtttgtgatccgcagagcagccaccaatcgtgtcttgaacgtgctccgccac
tgggtgtccaagcactctcaggactttgaaaccaacgatgagctcaaatgcaaggtgatc
ggcttcctggaagaagtcatgcacgacccggagctcctgacccaggagcggaaggctgca
gccaacatcatcaggactctgacccaggaggacccaggtgacaaccagatcacgctggag
gagatcacacagatggctgaaggcgtgaaggctgagccctttgaaaaccactcggcccta
gagattgcggagcagctgaccctgctagaccacctcgtcttcaagaagattccttatgag
gagttcttcggacaaggatggatgaaactggaaaagaatgaaaggaccccttatatcatg
aaaaccaccaagcacttcaatgatatcagtaacttgattgcttcagaaatcatccgcaat
gaggacatcaatgccagggtgagcgccatcgagaagtgggtggccgtggctgacatctgc
cgctgcctccacaactacaatgctgtgctggagatcacctcatccatgaaccgcagtgca
atcttccggctcaaaaagacatggctcaaagtctctaagcagactaaagctttgattgat
aagctccaaaagcttgtgtcatctgagggcagatttaagaatctcagagaagctctgaaa
aattgtgacccaccctgtgtcccttacctggggatgtacctcaccgacctggccttcatc
gaggaggggacgcccaattacacggaagacggcctggtcaacttctccaagatgaggatg
atatcccatattatccgagagattcgccagtttcaacaaactgcctacaaaatagagcac
caagcaaaggtaacgcaatatttactggaccaatcttttgtaatggacgaagaaagcctc
tacgagtcttctctccgaatagaaccaaaactccccacctga

DBGET integrated database retrieval system