KEGG   Macaca mulatta (rhesus monkey): 717129Help
Entry
717129            CDS       T01028                                 

Definition
(RefSeq) ras-specific guanine nucleotide-releasing factor 1-like
  KO
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
Ras signaling pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    717129
   04010 MAPK signaling pathway
    717129
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    717129
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 793 aa AA seqDB search
MSEKGKITRGRLGSLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLE
EPESTEEEAKGSSQDIDHLDFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVDNIR
CNGLMMNAFEENSKVTVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERL
TDLRFLSIDFLNTFLHSYRVFTTAVVVLDKLITIYKKPISAIPARWLRSLELLFASGQNN
KLLYGDPPKSPRATRKFSSPPPLSITKTSSPSRRRKLSLNIPIITGGKALDLAALSCNSN
GYTSMYSAMSPFSKATLDTSKLYVSSSFTNKIPDEGDTTPEKPEDPSVLSKQSSEVSVRE
ESDTDQNQSDDGDTETSPTKSPTTPKSVKSKNSSEFPLFSYNNGVVMTSCRELDNNRSAL
SAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRH
WVSKHSQDFETNDELKCKVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLE
EITQMAEGVKAEPFENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIM
KTTKHFNDISNLIASEIIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSA
IFRLKKTWLKVSKQTKALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFI
EEGTPNYTEDGLVNFSKMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESL
YESSLRIEPKLPT
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaagggcaagatcaccagagggcgcctggggtctctctccctaaagaaagag
ggtgaacgacagtgcttcctgttttctaagcatctgattatctgtaccagaggctctgga
gggaagcttcacctgaccaagaatggagtcatatccctcattgactgcactttattggag
gagccagaaagcacggaggaggaagccaaaggatccagccaagacatagatcacttggat
tttaaaatcggggtggagccaaaggattccccgccctttacggtcatcctagtggcctcg
tccagacaggagaaggcggcgtggaccagtgacatcagccagtgtgtggataacatccga
tgcaatgggctcatgatgaacgcgtttgaagaaaattccaaggtcactgtgccacagatg
atcaagtctgacgcctccttatattgtgatgatgttgacattcgcttcagcaaaaccatg
aactcctgcaaagtgcttcagatccgctacgccagcgtggagcggctgctggagaggctg
acagacctgcgcttcctgagcatcgacttcctcaacaccttcctgcactcctaccgggtc
ttcaccaccgccgtcgtggtcctggacaagctcattaccatctacaagaagcctatcagt
gccatacctgccaggtggctgaggtcgctggagcttctgtttgccagtggccagaacaac
aagcttctgtacggtgacccccccaagtccccgcgcgccacccgcaagttctcctcgcca
ccacctctgtccatcaccaagacatcttcgccaagccgccggcggaagctctccctgaac
atccccattatcaccggcggcaaggccctggacctggccgccctcagctgcaactccaat
ggctacaccagcatgtactcggccatgtcacccttcagcaaggccacactggacaccagc
aagctctatgtgtccagcagcttcaccaacaagattccagatgagggcgatacgacccct
gagaagcccgaagacccttcagtgctcagcaagcagagctcagaagtctccgtgagagag
gagtcagatactgatcaaaaccagagtgatgatggtgatactgaaacatcaccaactaaa
tctccaacaacacccaaatcagtcaaaagcaaaaattcttcagagttcccgcttttttcc
tataacaacggagtcgtcatgacctcctgtcgcgaactggacaataaccgcagtgccttg
tcagctgcctccgcctttgccatagcaaccgcgggggccaacgagggcaccccaaacaag
gagaagtaccggaggatgtccttagccagtgcagggtttcccccagaccagaggaatgga
gacaaggagtttgtgatccgcagagcagccaccaatcgtgtcttgaacgtgctccgccac
tgggtgtccaagcactctcaggactttgaaaccaacgatgagctcaaatgcaaggtgatc
ggcttcctggaagaagtcatgcacgacccggagctcctgacccaggagcggaaggctgca
gccaacatcatcaggactctgacccaggaggacccaggtgacaaccagatcacgctggag
gagatcacacagatggctgaaggcgtgaaggctgagccctttgaaaaccactcggcccta
gagattgcggagcagctgaccctgctagaccacctcgtcttcaagaagattccttatgag
gagttcttcggacaaggatggatgaaactggaaaagaatgaaaggaccccttatatcatg
aaaaccaccaagcacttcaatgatatcagtaacttgattgcttcagaaatcatccgcaat
gaggacatcaatgccagggtgagcgccatcgagaagtgggtggccgtggctgacatctgc
cgctgcctccacaactacaatgctgtgctggagatcacctcatccatgaaccgcagtgca
atcttccggctcaaaaagacatggctcaaagtctctaagcagactaaagctttgattgat
aagctccaaaagcttgtgtcatctgagggcagatttaagaatctcagagaagctctgaaa
aattgtgacccaccctgtgtcccttacctggggatgtacctcaccgacctggccttcatc
gaggaggggacgcccaattacacggaagacggcctggtcaacttctccaagatgaggatg
atatcccatattatccgagagattcgccagtttcaacaaactgcctacaaaatagagcac
caagcaaaggtaacgcaatatttactggaccaatcttttgtaatggacgaagaaagcctc
tacgagtcttctctccgaatagaaccaaaactccccacctga

DBGET integrated database retrieval system