KEGG   Macaca mulatta (rhesus monkey): 717178Help
Entry
717178            CDS       T01028                                 

Gene name
USP24
Definition
ubiquitin specific peptidase 24
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 2624 aa AA seqDB search
MESEEEQHMTTLLCMGFSDPATIRKALRLAKNDINEAVALLTNERPGLDYGGYEPMDSGG
GPSPGPGGGPRGDGGGDGGGGPSRGGSTGGGGGFDPPPAYHEVVDAEKNDENGNCSGEGI
EFPTTNLYELESRVLTDHWSIPYKREESLGKCLLASTYLARLGLSESDENCKRFMDRCMP
EAFKKLLTSSAVHKWGTEIHEGIYNMLMLLIELVAERIKQDPIPIGLLGVLTMAFNPDNE
YHFKNRMKVSQRNWAEVFGEGNMFAVSPVSTFQKEPHGWVVDLVNKFGELGGFAAIQAKL
HSEDIELGAVSALIQPLGVCAEYLSSSVVQPMLDPVILTTIQDVRSVEEKDLKDKRLVSI
PELLSAIKLLCMRFQPDLVTIVDDLRLDILLRMLKSPHFSAKMNSLKEVTKLIEDSTLSK
SVKNAIDTDRLLDWLVENSVLSIALEGNIDQAQYCDRIKGIIELLGSKLSLDELTKIWKI
QSGQSSTVIENIHTIIAAAAVKFNSDQLNHLFVLIQKSWETESDRVRQKLLSLIGRIGRE
ARFETTSGKVLDVLWELAHLPTLPSSLIQQALEEHLTILSDAYAVKEAIKRSYIIKCIED
IKRPGEWSGLEKNKKDGFKSSQLNNPQFVWVVPALRQLHEITRSFIKQTYQKQDKSIIQD
LKKNFEIVKLVTGSLIACHRLAAAVAGPGGLSSSTLVDGRYTYREYLEAHLKFLAFFLQE
ATLYLGWNRAKEIWECLVTGQDVCELDREMCFEWFTKGQHDLESDVQQQLFKEKILKLES
YEITMNGFNLFKTFFENVNLCDHRLKRQGAQLYVEKLELIGMDFIWKIAMESPDEEIANE
AIQLIINYSYINLNPRLKKDSVSLHKKFIADCYTRLEAASSALGGPTLTHAVTRATKMLT
ATAMPTVATSVQSPYRSTKLVIIERLLLLAERYVITIEDFYSVPRTILPHGASFHGHLLT
LNVTYESTKDTFTVEAHSNETIGSVRWKIAKQLCSPMDNIQIFTNDSLLTVNKDQKLLHQ
LGFSDEQILTVKTSGSGTPSGSSADSSTSSSSSSSGVFSSSYAMEQEKSLPGVVMALVCN
VFDMLYQLANLEEPRITLRVRKLLLLIPTDPAIQEALDQLDSLGRKKTLLSESSSQSSKS
PSLSSKQQHQPSASSILESLFRSFAPGMSTFRVLYNLEVLSSKLMPTADDDMARSCAKSF
CENFLKAGGLSLVVNVMQRDSIPSEVDYETRQGVYSICLQLARFLLVGQTMPTLLDEDLT
KDGIEALSSRPFRNVSRQTSRQMSLCGTPEKSSYRQLSVSDRSSIRVEEIIPAARVAIQT
MEVSDFTSTVACFMRLSWAAAAGRLDLVGSSQPIKESNSLCPAGIRNRLSSSGSNCSSGS
EGEPVALHAGICVRQQSVSTKDSLIAGEALSLLVTCLQLRSQQLASFYNLPCVADFIIDI
LLGSPSAEIRRVACDQLYTLSQTDTSAHPDVQKPNQFLLGVILTAQLPLWSPTSIMRGVN
QRLLSQCMEYFDLRCQLLDDLTTSEMEQLRISPATMLEDEITWLDNFEPNRTAECETSEA
DNILLAGHLRLIKTLLSLCGAEKEMLGSSLIKPLLDDFLFRASRIILNSHSPAGSAAIIQ
QDFHPKYGKCTCSTANSRLAAYEVLVMLADSSPSNLQIIIKELLSMHHQPDPALTKEFDY
LPPVDSRSSSGFVGLRNGGATCYMNAVFQQLYMQPGLPESLLSVDDDTDNPDDSVFYQVQ
SLFGHLMESKLQYYVPENFWKIFKMWNKELYVREQQDAYEFFTSLIDQMDEYLKKMGRDQ
IFKNTFQGIYSDQKICKDCPHRYEREEAFMALNLGVTSCQSLEISLDQFVRGEVLEGSNA
YYCEKCKEKRITVKRTCIKSLPSVLVIHLMRFGFDWESGRSIKYDEQIRFPWMLNMEPYT
VSGMARQDSSSEVGENGRSMDQGGGGSPRKKVALTENYELVGVIVHSGQAHAGHYYSFIK
DRRGCGKGKWYKFNDTVIEEFDLNDETLEYECFGGEYRPKVYDQTNPYTDVRRRYWNAYM
LFYQRVSDQNSPVLPKKSRVSVVRQEAEDLSLSAPSSPEISPQSSPRPHRPNNDRLSILT
KLVKKGEKKGLFVEKMPARIYQMVRDENLKFMKNRDVYSSDYFSFVLSLASLNATKLKHP
YYPCMAKVSLQLAIQFLFQTYLRTKKKLRVDTEEWIATIEALLSKSFDACQWLVEYFISS
EGRELIKIFLLECSVREVRVAVATILEKTLDSALFYQDKLKSLHQLLEVLLALLDKDVPE
NCKNCAQYFFLFNTFVQKQGIRAGDLLLRHSALRHMISFLLGANRQNNQIRRWSSAQARE
FGNLHNTVALLVLHSDVSSQRNVAPGLFKQRPPISIAPSSPLLPLHEEVEALLFMSEGKP
YLLEVMFALRELTGSLLALIEMVVYCCFCNEHFSFTMLHFIKNQLETAPPHELKNTFQLL
HEILVIEDPIQVERVKFVFETENGLLALMHHSNHVDSSRCYQCVKFLVTLAQKCPAAKEY
FKENSHHWSWAVQWLQKKMSEHYWTPQSNVSNETSTGKTFQRTISAQDTLAYATALLNEK
EQSGSSNGSESSPANENGDRHLQQGSESPMMIGELRSDLDDVDP
NT seq 7875 nt NT seq  +upstreamnt  +downstreamnt
atggaatcggaggaggagcagcacatgaccacgctgctgtgcatgggcttctcggacccc
gccaccattcgcaaggccctgcgcctggccaagaacgacatcaacgaggccgtggcgctg
ctcaccaacgagcggccgggcctcgactacggcggctacgagcccatggacagcggcggc
ggccccagccccgggcccggtgggggcccgcggggcgacggcggaggtgacggcggcggc
ggcccctcccgcggcgggagcaccggaggcgggggcggcttcgaccccccgcccgcctac
cacgaggtggtggacgcggagaagaatgatgaaaatggaaactgctcaggggaaggaatt
gaattccctacaacaaatttatatgagctggaaagccgtgttttgactgatcattggtcc
atcccttacaagcgagaagaatcactaggcaaatgcctgttggcatctacctacctagca
aggcttggtctttccgagtctgatgagaattgtaaaaggtttatggatagatgtatgcct
gaagcatttaaaaagctcctgacatcaagtgctgttcacaagtggggtactgaaattcat
gaaggaatttacaacatgttgatgctgctaatagaactggttgcagagagaataaaacaa
gatccaattcccattggtctcctgggtgtgcttacaatggctttcaatcctgataatgaa
taccattttaagaacagaatgaaagtgtctcaaaggaattgggcagaagtgtttggagag
ggaaatatgtttgctgtttcacctgtatccactttccaaaaggagcctcatggatgggtt
gtggatttggtaaataagtttggagaattaggtggatttgcagcaatccaagccaagctc
cattcagaagatatagaacttggggctgtctcagcactgattcaacccttgggagtgtgt
gcagagtacctcagttcctccgtggtacagcccatgctagacccagtcattcttactaca
atccaggatgtacggagcgtagaagagaaagacctcaaagacaagagattagttagcatc
cctgagctcttgtctgccattaagttactttgcatgcgcttccaaccggatctagtgaca
attgtggatgaccttcgactagatattctactgcgcatgctgaaatcaccacatttcagt
gctaagatgaattctctcaaagaagtaaccaaactaatagaagatagcactttatccaaa
tctgtgaagaatgctatagatacggacagattattagattggctagttgaaaactcagtt
ctgtcaattgcactagaaggcaacatagaccaagcacaatattgtgaccgtataaaggga
attattgaactcttgggtagtaaattgtcgttagatgagctcactaaaatttggaagata
cagtcaggacaatcatctaccgtgattgagaacattcatactattattgctgcagcagct
gtgaaatttaattcagatcagcttaatcatttgtttgttctcattcagaagagctgggag
actgagagtgatagagtaagacagaagctgttgagcctgattggacgaataggccgggaa
gctcgctttgagaccacttctggaaaggtattagacgtgctctgggaactggctcacctt
ccaaccctgcccagtagccttattcagcaggccttggaggagcacctgacaatccttagt
gatgcgtatgcagtgaaagaagcaatcaagaggagctacatcatcaagtgcatagaagat
attaagaggcctggagaatggtcaggtttggaaaaaaacaagaaggatggattcaagtca
tctcagcttaataatcctcagtttgtatgggtggtaccagctttacgtcagctccatgaa
attactcgctcattcataaaacaaacttatcaaaagcaagacaagagcattattcaagac
ttgaagaaaaattttgaaatagtgaaattggtaacgggaagtttgatcgcttgtcatcgg
cttgcagctgctgtggccgggcctggaggcttaagtagctctacactagtggatggccgg
tacacttaccgggagtatttagaagcacatctaaaatttctggcatttttcttgcaagaa
gctactctgtatctgggctggaatcgtgccaaggagatctgggagtgtcttgtaactggc
caggatgtttgtgaattagatagagagatgtgttttgaatggtttacaaaagggcagcat
gatctcgagagtgatgttcagcaacagctcttcaaggagaaaattcttaaattggagtca
tatgaaatcactatgaatggttttaacttatttaaaactttttttgaaaatgtgaatctt
tgtgatcatcgattgaaaagacaaggagctcagttgtatgtagaaaagctggaattgata
ggaatggatttcatttggaaaatagccatggaatcacctgatgaagaaattgctaatgaa
gctattcagctaatcataaactatagttacattaatctaaatcctagattaaagaaggat
tcagtatctttacataagaaattcattgctgattgctacacaagattagaagcagccagt
tcagcacttggtggccccactctaacacatgctgtgaccagagcaacaaaaatgcttaca
gcaactgccatgccaactgtagcaacctcagttcagtctccttatagatccactaaactt
gtaataattgagagactgctgcttctggcagagcgctatgtgatcactatagaggatttt
tactctgttccacgaactattctacctcatggtgcctcatttcatggacatcttttaact
cttaatgttacctatgagtctaccaaagataccttcactgtcgaggctcacagtaatgaa
accatagggagtgtccggtggaaaatagccaagcagttgtgctctcctatggataatata
cagatatttacaaatgatagcctgctgacagtgaataaagatcaaaagctactccaccaa
ctgggcttttctgatgaacagatccttacagtgaagacttctggcagtgggaccccatct
gggagttcagcagattcttcaaccagctccagcagcagcagcagtggggtttttagttct
tcatacgccatggagcaggagaaatccctccctggcgtagtgatggctctcgtatgtaat
gtatttgacatgctttatcagctcgccaatctggaagagccaaggataactctacgagta
cggaagcttctgctcttgatacctactgatccagccattcaggaagcccttgatcaactt
gattctttaggaagaaagaaaacattgctgtctgaatcaagttctcagtcctcaaaatct
ccatccctgtcatcaaagcaacagcaccagccaagtgccagttcaattttagaaagtctg
tttcgatcttttgccccgggaatgtctaccttcagagtgctctacaacttggaagttcta
agctccaaactcatgccaacagctgatgatgacatggccagaagctgtgccaaatccttc
tgtgaaaacttcctcaaagccggcggtttgagtttggttgtaaatgtcatgcagagagac
tccatcccatcagaagtagactatgaaacaaggcagggtgtttattccatctgtctacag
cttgcaagatttttacttgttggacaaacaatgcccacgttattagatgaagacctcacc
aaagatggcatagaagcactttcttcccgcccattccgaaatgtcagccggcagacaagc
agacagatgtccttatgtggtaccccagaaaagtcatcctaccgacagttgtcagtgtct
gacaggtcttctattagggttgaggaaatcatccctgctgctcgagttgcaatacaaacg
atggaagtaagtgatttcacttctactgtggcttgcttcatgagattgtcatgggctgcg
gctgcaggacggcttgatcttgttgggagtagccagccaattaaagaaagtaattccctg
tgtcctgctggaattcgaaacagactcagcagttcaggaagcaattgcagctctggaagt
gaaggagaaccggtagccctgcatgcaggaatctgtgttcgacaacagtctgtatccacc
aaagactcgctgattgcgggagaggctttgtctcttcttgttacgtgcctacagcttcgg
agccagcaactagcatctttctataacttgccctgtgttgctgatttcatcattgatatt
ctgctcggatcaccaagtgctgagattcgccgggttgcctgtgatcagctgtacactctt
agtcagacagacacatcagcgcatccggatgtgcagaagccaaatcagtttcttctaggc
gtcatcctcacggctcagctgcctctctggtctccaactagtattatgagaggagtcaat
cagagactgttatctcagtgtatggagtattttgatttgagatgccagttattagatgat
ctgacaacttcagaaatggagcagttaaggatcagcccagctaccatgcttgaagatgag
attacttggctggataactttgaacctaatcgcacagctgaatgtgagaccagtgaagcg
gacaacatcttactggcagggcacttacgcctcatcaagacccttctttcactctgtggg
gcagaaaaggaaatgcttggttcatcactcattaaaccattgttagatgacttccttttc
cgagcttctagaattattttaaatagtcattctccagctggcagtgccgccatcattcaa
caggactttcatccaaaatatggaaaatgcacgtgtagtacagcgaatagccgattggca
gcctatgaagtccttgtgatgttggctgatagttcaccttcaaatcttcaaattattata
aaagaactgctttctatgcatcaccaacctgaccctgctcttaccaaggagtttgattac
cttcccccagtggatagcaggtccagttcagggtttgtggggctgaggaatggtggtgca
acttgttatatgaatgcagtcttccagcagctgtatatgcaacctgggctccctgagtca
ttactttcggtggatgatgacacagacaatccagatgatagtgtgttttaccaagtgcag
tctctctttgggcatttaatggaaagcaagctgcagtattatgtacctgagaatttttgg
aagattttcaagatgtggaataaagaactttatgtgagagaacagcaggatgcatacgaa
ttctttactagtctcattgatcagatggatgaatatctcaagaaaatggggagagaccaa
atttttaagaatacatttcagggcatctactctgatcagaagatctgtaaagactgtcct
cacagatatgagcgtgaagaagctttcatggctctcaatctaggagtgacttcttgtcag
agtttggaaatttctttggaccaattcgttagaggagaagttctagagggaagtaacgcg
tactactgtgaaaagtgtaaagaaaagagaataacagtgaaaaggacctgtattaaatct
ttacctagcgtcttggtaattcacctaatgagatttggatttgactgggaaagtggacgt
tccattaaatatgatgaacaaataaggtttccctggatgctaaacatggagccttacaca
gtttcaggaatggctcgccaagattcttcttctgaagttggggaaaatgggcgaagtatg
gatcagggaggtggaggatccccacgaaaaaaggttgccctcacagaaaactatgaactt
gtcggtgtcatcgtacacagtgggcaggcacacgcaggccactactattccttcattaag
gacaggcgagggtgtggaaaaggaaagtggtataaatttaatgacacagttatagaagaa
tttgacctaaatgatgagaccctggagtatgaatgctttggaggagaatatagaccaaaa
gtttatgatcaaacaaacccatacactgatgtacgccgaagatactggaatgcctatatg
cttttctaccaaagggtgtctgatcagaactccccagtattaccaaagaaaagtcgagtc
agcgttgtacggcaggaagctgaggatctctctctgtcagctccatcttcaccagaaatt
tcacctcagtcatctcctcggccccataggcctaacaatgaccggctgtctattcttacc
aagctggttaaaaaaggtgagaagaaaggactgtttgtggagaaaatgcctgctcgaata
taccagatggtgagagatgagaacctcaagtttatgaagaatagagatgtgtacagtagt
gattatttcagttttgttttgtctttagcttcgttgaatgctactaaattaaagcatcca
tattatccttgcatggcaaaggtgagcttacagcttgctattcaattcctttttcaaact
tatctacggacaaagaagaaactcagggttgatactgaagaatggattgctaccattgaa
gcattgctttcaaaaagttttgatgcttgtcagtggttagttgaatattttattagttct
gaaggacgagaattgataaagattttcttactggagtgcagtgtgagagaagtacgagtt
gctgtggccaccattctggagaaaaccctagacagtgccttgttttatcaggataagcta
aaaagccttcatcagttactggaggtactgcttgctctattggacaaagacgtcccagaa
aattgtaaaaactgtgctcagtacttcttcctgttcaacacttttgtacaaaagcaagga
attagggctggagaccttcttctgaggcattcagctctgcggcacatgatcagcttcctc
ctaggggccaatcggcaaaacaatcagatacgtcgatggagttcagcacaagcacgagaa
tttgggaatcttcacaatacagtggcattacttgttttgcattcagatgtctcatcccaa
aggaatgttgctcctggcctatttaagcaacgaccacccattagcattgctccctcaagc
cctctgctgcccctccatgaggaggtagaagccttgttgttcatgtctgaagggaaacct
tacctgttagaggtaatgtttgccttgcgggagttgacaggctcgctcttggcactcatt
gagatggtagtgtactgctgtttctgtaatgagcatttttccttcacgatgctgcatttc
attaagaaccaactagaaacggctccaccccatgagttaaagaatacgttccaactactt
catgaaatattggttattgaagatcccatacaagtagagcgagtcaaatttgtgtttgag
acagaaaatggattactagctttgatgcaccacagtaatcatgtggacagcagtcgctgc
taccagtgtgtcaaatttcttgtcactcttgctcaaaagtgtcctgcagctaaggagtac
ttcaaggagaattcccaccactggagctgggctgtgcagtggctacagaagaagatgtca
gaacattattggacaccacagagtaatgtctctaatgaaacatcaactggaaaaaccttt
cagcgaaccatttcagctcaggacacgttagcgtatgccacagctttgttgaatgaaaaa
gagcaatcaggaagcagtaatgggtcggagagcagtcctgccaatgagaacggagacagg
catctacagcagggttcagaatctcccatgatgattggtgagttgagaagtgaccttgac
gatgttgatccctag

DBGET integrated database retrieval system