KEGG   Macaca mulatta (rhesus monkey): 717212Help
Entry
717212            CDS       T01028                                 

Definition
lysosomal thioesterase PPT2-like
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:mcc01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:mcc00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:mcc04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 308 aa AA seqDB search
MLGVWGQRLPAAWVLLLLPFLPLLLLQSPAPHRASYKPVIVVHGLFDSSYSFRHLLEYIN
ETHPGTVVTVLDLFDGRESLRPLWEQVQGFREAVVPIMAKAPQGVHLICYSQGRRLPCPX
LLSPIXGLILIXGTLPSVPFSEPHCSRHNPDTDYLKWLFPTSMRSNLYRICYSPWGQEFS
ICNYWHDPHHDDLYLNASSFLALINGERDHPNATVWRKNFLRVGHLVLIGGPDDGVITPW
QSSFFGFYDANETVLEMEEQLVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLYE
TCIEPWLS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgctgggtgtctgggggcagcggctccccgcggcgtgggtcctactcctgttacctttc
ctgccgctgctgctgctgcagtcccccgcgccccaccgcgcgtcctacaagccggtcatc
gtggtgcatgggctcttcgacagctcgtacagcttccgccacctgctggaatacatcaat
gagacacaccccgggactgtggtgacagtgctcgatctcttcgatgggagagagagcttg
cgacccctgtgggaacaggtgcaagggttccgagaggctgtggtccccatcatggcaaag
gcccctcaaggggtgcatctcatctgctactcgcagggtaggcgactcccctgcccctaa
ctcctaagccctatctgaggcttgatccttatctgagggacacttcctagtgtccctttt
tctgaaccacattgctccaggcacaaccctgacacggactacttgaagtggctgttcccc
acctccatgcggtctaacctctatcggatctgctatagcccctggggccaggaattctcc
atctgcaactactggcatgatccccaccacgatgacttgtacctcaatgccagcagcttc
ctagccctgatcaatggggaaagagaccatcccaatgccacagtatggcggaagaacttt
cttcgtgtgggccacctggtgctgattgggggccctgatgatggtgttattactccctgg
cagtccagcttctttggtttctatgatgcaaatgagacggtcctggagatggaggagcaa
ctggtttatctgcgggattcttttgggttgaagactctattggcccggggggccatagtg
aggtgtccgatggccgggatctcccacacagcctggcactccaaccgtaccctttatgag
acctgcattgaaccttggctctcctga

DBGET integrated database retrieval system