KEGG   Macaca mulatta (rhesus monkey): 717212Help
Entry
717212            CDS       T01028                                 

Definition
lysosomal thioesterase PPT2-like
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    717212
  Lipid metabolism
   00062 Fatty acid elongation
    717212
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    717212
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     717212
Lipid biosynthesis proteins [BR:mcc01004]
 Fatty acid synthase
  Component type
   717212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 308 aa AA seqDB search
MLGVWGQRLPAAWVLLLLPFLPLLLLQSPAPHRASYKPVIVVHGLFDSSYSFRHLLEYIN
ETHPGTVVTVLDLFDGRESLRPLWEQVQGFREAVVPIMAKAPQGVHLICYSQGRRLPCPX
LLSPIXGLILIXGTLPSVPFSEPHCSRHNPDTDYLKWLFPTSMRSNLYRICYSPWGQEFS
ICNYWHDPHHDDLYLNASSFLALINGERDHPNATVWRKNFLRVGHLVLIGGPDDGVITPW
QSSFFGFYDANETVLEMEEQLVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLYE
TCIEPWLS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgctgggtgtctgggggcagcggctccccgcggcgtgggtcctactcctgttacctttc
ctgccgctgctgctgctgcagtcccccgcgccccaccgcgcgtcctacaagccggtcatc
gtggtgcatgggctcttcgacagctcgtacagcttccgccacctgctggaatacatcaat
gagacacaccccgggactgtggtgacagtgctcgatctcttcgatgggagagagagcttg
cgacccctgtgggaacaggtgcaagggttccgagaggctgtggtccccatcatggcaaag
gcccctcaaggggtgcatctcatctgctactcgcagggtaggcgactcccctgcccctaa
ctcctaagccctatctgaggcttgatccttatctgagggacacttcctagtgtccctttt
tctgaaccacattgctccaggcacaaccctgacacggactacttgaagtggctgttcccc
acctccatgcggtctaacctctatcggatctgctatagcccctggggccaggaattctcc
atctgcaactactggcatgatccccaccacgatgacttgtacctcaatgccagcagcttc
ctagccctgatcaatggggaaagagaccatcccaatgccacagtatggcggaagaacttt
cttcgtgtgggccacctggtgctgattgggggccctgatgatggtgttattactccctgg
cagtccagcttctttggtttctatgatgcaaatgagacggtcctggagatggaggagcaa
ctggtttatctgcgggattcttttgggttgaagactctattggcccggggggccatagtg
aggtgtccgatggccgggatctcccacacagcctggcactccaaccgtaccctttatgag
acctgcattgaaccttggctctcctga

DBGET integrated database retrieval system