KEGG   Macaca mulatta (rhesus monkey): 717321Help
Entry
717321            CDS       T01028                                 

Gene name
CDC27
Definition
cell division cycle 27 homolog (S. cerevisiae)
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    717321 (CDC27)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    717321 (CDC27)
   04114 Oocyte meiosis
    717321 (CDC27)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    717321 (CDC27)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    717321 (CDC27)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     717321 (CDC27)
Ubiquitin system [BR:mcc04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     717321 (CDC27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
16
AA seq 790 aa AA seqDB search
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCL
PNSCTTQVPNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQN
YTNTPSVIDVPSTGAPSKKVFSITTPQVLSPTIASPPNALPRRSSRLFTSDSSTTKENSK
KLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKISTITPQIQAFNL
QKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSE
YMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAG
NCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRH
YNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNK
AIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTH
LALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDT
QLHAAESDEF
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgctgcaggaacccgttcaggctgctatatggcaagcactaaaccactatgct
taccgagatgcggttttcctcgcagaacgcctttatgcagaagtacactcagaagaagcc
ttgtttttactggcaacctgttattaccgctcaggaaaggcatataaagcttatagactg
ttgaaaggacacagttgtactacaccacaatgcaaatacctgcttgcaaaatgttgtgtt
gatctcagcaagcttgcagaaggggaacaaatcttatctggtggagtgtttaataagcag
aaaagccatgacgatattgttactgagtttggtgattcagcttgctttactctttcgttg
ttgggacatgtatattgcaagacagatcggcttgccaaaggatcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtctccttttgaatcattatgtgaaataggtgaa
aagccagatcctgaccaaacatttaaattcacatctttacagaactttagcaactgtctg
cccaactcttgcacaacacaagtacctaatcatagtttatctcacagacagcctgagaca
gttcttacggaaacaccccaggacacaattgaattaaacagattgaatttagaatcttcc
aattcaaagtactccttgaatacagattcctcagtgtcttatattgattcagctgtaatt
tcacctgatactgtcccactgggaacaggaacttccatattatctaaacaggttcaaaat
aaaccaaaaactggtcgaagtttattaggaggaccagcagctcttagcccattaacccca
agttttgggattttgccattagaaaccccaagtcctggagatggatcctatttacaaaac
tacactaatacaccttctgtaattgacgtgccatccaccggagccccttcaaaaaaggta
ttttccattacaacacctcaggtattgagccccacaattgcatctcccccaaacgcactg
cctcgaagaagttcacgactctttactagtgacagctccacaaccaaggagaatagcaaa
aaattaaaaatgaagtttccacctaaaatcccaaacagaaaaacaaaaagtaaaactaac
aaaggaggaataactcaacctaacataaatgatagcctggaaattacaaaattagactct
tccatcatttcagaagggaaaatatccacaatcacacctcagattcaggcttttaatcta
caaaaagcagcagcagaaggtttgatgagccttcttcgtgaaatggggaaaggttattta
gctttgtgttcatacaactgcaaagaagctataaatattttgagccatctaccttctcac
cactacaatactggttgggtactgtgccagattggaagggcctattttgaactttcagag
tacatgcaagctgaaagaatattctcagaggttagaaggattgagaattacagagttgaa
ggcatggaaatctactctacaacactttggcatcttcaaaaagatgttgctctttcagtt
ctgtcaaaagacttaacagacatggataaaaattcgccagaggcctggtgtgctgcaggg
aactgtttcagtctgcaacgggaacatgatattgcaattaaattcttccagagagctatc
caagttgatccaaattatgcttatgcctatactctgttagggcatgagtttgtcttaact
gaagaattggacaaagcattagcttgttttcgaaatgctatcagagtcaatcctagacat
tataatgcatggtatggtttaggaatgatttattacaagcaagaaaaattcagccttgca
gaaatgcatttccaaaaagcacttgatatcaaccctcaaagttcagttttactttgccac
attggagtagttcaacatgcactgaaaaaatcagagaaggctttggataccctaaacaaa
gccattgtcattgatcccaagaaccctctatgcaaatttcacagagcctcagttttattt
gcaaatgaaaaatataagtctgctttacaagaacttgaagaattgaaacaaattgttccc
aaagaatccctcgtttacttcttaataggaaaggtttacaagaagttaggtcaaacgcac
ctcgccctgatgaatttctcttgggctatggatttagatcctaaaggagccaataaccag
attaaagaggcaattgataagcgctatcttccagatgatgaggagccaataacccaagaa
gaacagatcatgggaacagatgaatcccaggagagcagcatgacagatgcggatgacaca
caacttcatgcagctgaaagtgatgaattttaa

DBGET integrated database retrieval system