KEGG   Macaca mulatta (rhesus monkey): 717321Help
Entry
717321            CDS       T01028                                 

Gene name
CDC27
Definition
(RefSeq) cell division cycle 27
  KO
K03350  anaphase-promoting complex subunit 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04110  Cell cycle
mcc04114  Oocyte meiosis
mcc04120  Ubiquitin mediated proteolysis
mcc04914  Progesterone-mediated oocyte maturation
mcc05166  HTLV-I infection
Module
mcc_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    717321 (CDC27)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    717321 (CDC27)
   04114 Oocyte meiosis
    717321 (CDC27)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    717321 (CDC27)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    717321 (CDC27)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     717321 (CDC27)
Ubiquitin system [BR:mcc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     717321 (CDC27)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    717321 (CDC27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_1 TPR_2 ANAPC3 TPR_8 TPR_12 TPR_11 TPR_17 TPR_16 TPR_19 TPR_14 TPR_6 TPR_9 ChAPs TPR_20 TPR_21 Cas_Cas02710
Motif
Other DBs
NCBI-GeneID: 717321
NCBI-ProteinID: XP_014974843
Ensembl: ENSMMUG00000018599
UniProt: H9ZG41
Position
16
AA seq 830 aa AA seqDB search
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCL
PNSCTTQVPNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQN
YTNTPSVIDVPSTGAPSKKTFCVLQSVARIGQTGTKSVFSQSGNSREVTPILAQTQSSGP
QTSTTPQVLSPTIASPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTN
KGGITQPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYL
ALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVE
GMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAI
QVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLA
EMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLF
ANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQ
IKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgctgcaggaacccgttcaggctgctatatggcaagcactaaaccactatgct
taccgagatgcggttttcctcgcagaacgcctttatgcagaagtacactcagaagaagcc
ttgtttttactggcaacctgttattaccgctcaggaaaggcatataaagcttatagactg
ttgaaaggacacagttgtactacaccacaatgcaaatacctgcttgcaaaatgttgtgtt
gatctcagcaagcttgcagaaggggaacaaatcttatctggtggagtgtttaataagcag
aaaagccatgacgatattgttactgagtttggtgattcagcttgctttactctttcgttg
ttgggacatgtatattgcaagacagatcggcttgccaaaggatcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtctccttttgaatcattatgtgaaataggtgaa
aagccagatcctgaccaaacatttaaattcacatctttacagaactttagcaactgtctg
cccaactcttgcacaacacaagtacctaatcatagtttatctcacagacagcctgagaca
gttcttacggaaacaccccaggacacaattgaattaaacagattgaatttagaatcttcc
aattcaaagtactccttgaatacagattcctcagtgtcttatattgattcagctgtaatt
tcacctgatactgtcccactgggaacaggaacttccatattatctaaacaggttcaaaat
aaaccaaaaactggtcgaagtttattaggaggaccagcagctcttagcccattaacccca
agttttgggattttgccattagaaaccccaagtcctggagatggatcctatttacaaaac
tacactaatacaccttctgtaattgacgtgccatccaccggagccccttcaaaaaagact
ttttgtgttttacagtctgttgccagaatcggccaaactggaacaaagtctgtcttctca
cagagtggaaatagccgagaggtaactccaattcttgcacaaacacaaagttctggtcca
caaacaagtacaacacctcaggtattgagccccacaattgcatctcccccaaacgcactg
cctcgaagaagttcacgactctttactagtgacagctccacaaccaaggagaatagcaaa
aaattaaaaatgaagtttccacctaaaatcccaaacagaaaaacaaaaagtaaaactaac
aaaggaggaataactcaacctaacataaatgatagcctggaaattacaaaattagactct
tccatcatttcagaagggaaaatatccacaatcacacctcagattcaggcttttaatcta
caaaaagcagcagcagaaggtttgatgagccttcttcgtgaaatggggaaaggttattta
gctttgtgttcatacaactgcaaagaagctataaatattttgagccatctaccttctcac
cactacaatactggttgggtactgtgccagattggaagggcctattttgaactttcagag
tacatgcaagctgaaagaatattctcagaggttagaaggattgagaattacagagttgaa
ggcatggaaatctactctacaacactttggcatcttcaaaaagatgttgctctttcagtt
ctgtcaaaagacttaacagacatggataaaaattcgccagaggcctggtgtgctgcaggg
aactgtttcagtctgcaacgggaacatgatattgcaattaaattcttccagagagctatc
caagttgatccaaattatgcttatgcctatactctgttagggcatgagtttgtcttaact
gaagaattggacaaagcattagcttgttttcgaaatgctatcagagtcaatcctagacat
tataatgcatggtatggtttaggaatgatttattacaagcaagaaaaattcagccttgca
gaaatgcatttccaaaaagcacttgatatcaaccctcaaagttcagttttactttgccac
attggagtagttcaacatgcactgaaaaaatcagagaaggctttggataccctaaacaaa
gccattgtcattgatcccaagaaccctctatgcaaatttcacagagcctcagttttattt
gcaaatgaaaaatataagtctgctttacaagaacttgaagaattgaaacaaattgttccc
aaagaatccctcgtttacttcttaataggaaaggtttacaagaagttaggtcaaacgcac
ctcgccctgatgaatttctcttgggctatggatttagatcctaaaggagccaataaccag
attaaagaggcaattgataagcgctatcttccagatgatgaggagccaataacccaagaa
gaacagatcatgggaacagatgaatcccaggagagcagcatgacagatgcggatgacaca
caacttcatgcagctgaaagtgatgaattttaa

DBGET integrated database retrieval system